PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information? help Back to Top

TF ID

89813

Common Name

MICPUN_89813, NFYB

Organism

Taxonomic ID

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas

Family

Protein Properties

Length: 139aa MW: 15371.1 Da PI: 4.7752

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
89813	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	188.8	3.9e-59	20	116	1	97
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 vreqdrflPian+srimkk+lPanaki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa++tlGfe+yveplkvyl+kyre+egek 89813 20 VREQDRFLPIANISRIMKKALPANAKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMSTLGFEEYVEPLKVYLHKYRETEGEK 116 69********************************************************************************************997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.0E-56	16	126	IPR009072	Histone-fold
SuperFamily	SSF47113	2.33E-41	23	124	IPR009072	Histone-fold
Pfam	PF00808	2.0E-28	26	90	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	7.7E-23	54	72	No hit	No description
PROSITE pattern	PS00685	0	57	73	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	7.7E-23	73	91	No hit	No description
PRINTS	PR00615	7.7E-23	92	110	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 139 aa Download sequence Send to blast
MSDANDPDVD DDDDDKGGNV REQDRFLPIA NISRIMKKAL PANAKIAKDA KETVQECVSE 60 FISFITSEAS DKCQREKRKT INGDDLLWAM STLGFEEYVE PLKVYLHKYR ETEGEKATSI 120 KHGDAAAKKA DVSGKQTS*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	7e-49	20	111	1	92	Transcription factor HapC (Eurofung)
4g92_B	7e-49	20	111	1	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	CP001574	0.0	CP001574.1 Micromonas sp. RCC299 chromosome 1, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002507332.1	1e-98	histone-like transcription factor
Swissprot	O23310	1e-65	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBL	C1FEL2	3e-97	C1FEL2_MICCC; Histone-like transcription factor
STRING	XP_002507332.1	5e-98	(Micromonas sp. RCC299)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Chlorophytae	OGCP2023	16	16

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	3e-67	nuclear factor Y, subunit B3

Link Out ? help Back to Top
Phytozome	89813
Entrez Gene	8250638

Publications ? help Back to Top
Worden AZ, et al. Green evolution and dynamic adaptations revealed by genomes of the marine picoeukaryotes Micromonas. Science, 2009. 324(5924): p. 268-72 [PMID:19359590] Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]