PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 89924
Common NameCDF1A-1, SELMODRAFT_440428
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family Dof
Protein Properties Length: 52aa    MW: 6162.99 Da    PI: 9.9618
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
89924genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.31.7e-38152859
  zf-Dof  8 cprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
            cprCds++tkfCyynny+++qPr+fCk+C+ryWt GG+lrnvPvG+grrknk
   89924  1 CPRCDSMDTKFCYYNNYNINQPRHFCKNCQRYWTSGGTLRNVPVGAGRRKNK 52
            9*************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088428.649152IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-23152IPR003851Zinc finger, Dof-type
PROSITE patternPS013610137IPR003851Zinc finger, Dof-type
PfamPF027012.7E-32152IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 52 aa     Download sequence    Send to blast
CPRCDSMDTK FCYYNNYNIN QPRHFCKNCQ RYWTSGGTLR NVPVGAGRRK NK
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Regulates a photoperiodic flowering response. Transcriptional repressor of 'CONSTANS' expression. The stability of CDF2 is controlled by 'GIGANTEA' and redundantly by ADO3, ADO2 and/or ADO1. {ECO:0000250, ECO:0000269|PubMed:19619493}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Highly expressed at the beginning of the light period, then decreases, reaching a minimum between 16 and 29 hours after dawn before rising again at the end of the day. Regulated at the protein level by ADO3 and GI pos-transcriptionally. {ECO:0000269|PubMed:19619493}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002968285.22e-33cyclic dof factor 3
RefseqXP_002976092.22e-33cyclic dof factor 2
SwissprotQ93ZL52e-30CDF2_ARATH; Cyclic dof factor 2
TrEMBLD8RBP56e-32D8RBP5_SELML; Uncharacterized protein CDF1A-1
TrEMBLD8RXY35e-32D8RXY3_SELML; Uncharacterized protein CDF1A-2
STRINGEFJ229978e-33(Selaginella moellendorffii)
STRINGEFJ305391e-32(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.28e-33cycling DOF factor 2
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]