PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

89924

Common Name

CDF1A-1, SELMODRAFT_440428

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

Dof

Protein Properties

Length: 52aa MW: 6162.99 Da PI: 9.9618

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
89924	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	122.3	1.7e-38	1	52	8	59
zf-Dof 8 cprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 cprCds++tkfCyynny+++qPr+fCk+C+ryWt GG+lrnvPvG+grrknk 89924 1 CPRCDSMDTKFCYYNNYNINQPRHFCKNCQRYWTSGGTLRNVPVGAGRRKNK 52 9*************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50884	28.649	1	52	IPR003851	Zinc finger, Dof-type
ProDom	PD007478	2.0E-23	1	52	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	1	37	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	2.7E-32	1	52	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 52 aa Download sequence Send to blast
CPRCDSMDTK FCYYNNYNIN QPRHFCKNCQ RYWTSGGTLR NVPVGAGRRK NK

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Regulates a photoperiodic flowering response. Transcriptional repressor of 'CONSTANS' expression. The stability of CDF2 is controlled by 'GIGANTEA' and redundantly by ADO3, ADO2 and/or ADO1. {ECO:0000250, ECO:0000269\|PubMed:19619493}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation. Highly expressed at the beginning of the light period, then decreases, reaching a minimum between 16 and 29 hours after dawn before rising again at the end of the day. Regulated at the protein level by ADO3 and GI pos-transcriptionally. {ECO:0000269\|PubMed:19619493}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002968285.2	2e-33	cyclic dof factor 3
Refseq	XP_002976092.2	2e-33	cyclic dof factor 2
Swissprot	Q93ZL5	2e-30	CDF2_ARATH; Cyclic dof factor 2
TrEMBL	D8RBP5	6e-32	D8RBP5_SELML; Uncharacterized protein CDF1A-1
TrEMBL	D8RXY3	5e-32	D8RXY3_SELML; Uncharacterized protein CDF1A-2
STRING	EFJ22997	8e-33	(Selaginella moellendorffii)
STRING	EFJ30539	1e-32	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP38	17	445

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G39660.2	8e-33	cycling DOF factor 2

Link Out ? help Back to Top
Phytozome	89924
Entrez Gene	9631460

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]