![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 899680 | ||||||||
| Common Name | ARALYDRAFT_899680 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 114aa MW: 13465.6 Da PI: 6.2613 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 156.5 | 4.6e-49 | 15 | 113 | 1 | 99 |
NF-YC 1 qlksfwekqiekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99
qlk+fw+k++e + dfknh++P++rik+i+k+d+dv+mi+aeaP+l+ska e+fi++lt+r wlha+e kr +++ diaaav++t+ifdfl+d+v ++
899680 15 QLKNFWSKEMEGDLDFKNHKFPITRIKRIMKFDPDVNMIAAEAPILFSKANEMFIMDLTMRLWLHAQERKRLKIQRFDIAAAVAQTVIFDFLLDEVTKE 113
89*********************************************************************************************9875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 3.52E-25 | 3 | 106 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 6.2E-29 | 28 | 97 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.2E-14 | 34 | 97 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 114 aa Download sequence Send to blast |
MENNNHQQPP QDNEQLKNFW SKEMEGDLDF KNHKFPITRI KRIMKFDPDV NMIAAEAPIL 60 FSKANEMFIM DLTMRLWLHA QERKRLKIQR FDIAAAVAQT VIFDFLLDEV TKE* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_B | 3e-32 | 22 | 110 | 5 | 93 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 899680 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002865812.1 | 2e-63 | nuclear transcription factor Y subunit C-8 | ||||
| Swissprot | Q4PSE2 | 7e-57 | NFYC8_ARATH; Nuclear transcription factor Y subunit C-8 | ||||
| TrEMBL | D7L2N7 | 5e-77 | D7L2N7_ARALL; Uncharacterized protein | ||||
| STRING | scaffold_303650.1 | 9e-78 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM17675 | 5 | 10 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G27910.1 | 3e-59 | nuclear factor Y, subunit C8 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 899680 |
| Entrez Gene | 9319913 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




