![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 901783 | ||||||||
| Common Name | ARALYDRAFT_901783 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 69aa MW: 7778.8 Da PI: 7.6837 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 46.5 | 1e-14 | 18 | 65 | 3 | 50 |
HHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--H CS
HSF_DNA-bind 3 lkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnf 50
l ++ye+++d++++ +isws++g+sf+v++++ef+k++Lp+ F h++f
901783 18 LDRTYEVVDDPSTDAIISWSQSGKSFIVWNPSEFSKDLLPRCFGHHHF 65
6789*****************************************987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00415 | 4.6E-4 | 10 | 67 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 5.44E-13 | 16 | 65 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Gene3D | G3DSA:1.10.10.10 | 7.7E-15 | 16 | 65 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 1.2E-6 | 17 | 40 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 2.7E-11 | 19 | 65 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.2E-6 | 55 | 67 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 69 aa Download sequence Send to blast |
MVKTKSSVAL RRAFVTHLDR TYEVVDDPST DAIISWSQSG KSFIVWNPSE FSKDLLPRCF 60 GHHHFLDA* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 901783 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002870105.1 | 2e-34 | heat stress transcription factor A-4a | ||||
| Swissprot | Q40152 | 3e-16 | HSF8_SOLLC; Heat shock factor protein HSF8 | ||||
| TrEMBL | D7LJJ5 | 4e-43 | D7LJJ5_ARALL; Uncharacterized protein | ||||
| STRING | scaffold_401284.1 | 6e-44 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM13231 | 11 | 27 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G18870.1 | 2e-18 | HSF family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 901783 |
| Entrez Gene | 9315223 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




