![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 902030 | ||||||||
| Common Name | ARALYDRAFT_902030 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 102aa MW: 12380.2 Da PI: 10.8074 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 26.7 | 1.3e-08 | 35 | 75 | 3 | 45 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
++T++E++l+ + +++ G + W++Ia ++ gR +k++ +w
902030 35 NMTEQEEDLIFRMHRLVGDR-WDLIAGRVV-GREAKDIERYWI 75
68****************99.*********.***********5 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 4.6E-5 | 32 | 80 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.61E-5 | 35 | 74 | No hit | No description |
| Pfam | PF00249 | 4.8E-8 | 35 | 75 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 1.06E-6 | 36 | 75 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 7.2E-10 | 36 | 75 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:1900033 | Biological Process | negative regulation of trichome patterning | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 102 aa Download sequence Send to blast |
MDNTNRLRPL RSPKQTKFTL RYSEEVSSVK WEFTNMTEQE EDLIFRMHRL VGDRWDLIAG 60 RVVGREAKDI ERYWIMRNCD HCSHKRRRRF HKLSRFSISP P* |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 76 | 88 | RNCDHCSHKRRRR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation. May function by suppressing the expression of GL3. {ECO:0000269|PubMed:22168948}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 902030 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CP002685 | 6e-54 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. | |||
| GenBank | FJ972677 | 6e-54 | FJ972677.1 Arabidopsis thaliana ecotype Gr-1 trichomeless2 (TCL2) gene, complete cds. | |||
| GenBank | FJ972679 | 6e-54 | FJ972679.1 Arabidopsis thaliana ecotype Oy-0 trichomeless2 (TCL2) gene, complete cds. | |||
| GenBank | FJ972680 | 6e-54 | FJ972680.1 Arabidopsis thaliana ecotype Landsberg erecta trichomeless2 (TCL2) gene, complete cds. | |||
| GenBank | FJ972681 | 6e-54 | FJ972681.1 Arabidopsis thaliana ecotype Col-0 trichomeless2 (TCL2) gene, complete cds. | |||
| GenBank | U93215 | 6e-54 | U93215.3 Arabidopsis thaliana chromosome 2 BAC T6B20 genomic sequence, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002881109.1 | 1e-70 | MYB-like transcription factor TCL2 isoform X1 | ||||
| Swissprot | B3H4X8 | 1e-58 | TCL2_ARATH; MYB-like transcription factor TCL2 | ||||
| TrEMBL | D7LC51 | 2e-69 | D7LC51_ARALL; Uncharacterized protein | ||||
| STRING | scaffold_401531.1 | 4e-70 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM323 | 28 | 194 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G30424.1 | 5e-61 | MYB_related family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 902030 |
| Entrez Gene | 9317176 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




