![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 902497 | ||||||||
| Common Name | ARALYDRAFT_902497 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 171aa MW: 18901.4 Da PI: 9.1132 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 124.2 | 4.2e-39 | 54 | 112 | 2 | 60 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
++k+++cprC+s++tkfCy+nny+++qPr+fCk C+ryWt+GGalrnvPvG+grrk+k
902497 54 PDKIIACPRCKSMETKFCYFNNYNVNQPRHFCKDCHRYWTAGGALRNVPVGAGRRKSKP 112
68999***************************************************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 1.0E-29 | 53 | 111 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 3.0E-32 | 56 | 111 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 28.127 | 58 | 112 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 60 | 96 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:1902455 | Biological Process | negative regulation of stem cell population maintenance | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 171 aa Download sequence Send to blast |
MATQDSQGIK LFGKTIAFNS QTIKNEEEKQ PPEQEATTTV RSSSSSDLTA EKRPDKIIAC 60 PRCKSMETKF CYFNNYNVNQ PRHFCKDCHR YWTAGGALRN VPVGAGRRKS KPPGRAVVGM 120 LGDGNGVHQV ELINGLLVEE WQHAAAAAHG GFRHDFPMKR LRCYSDGQSC * |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 902497 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC002341 | 0.0 | AC002341.3 Arabidopsis thaliana chromosome 2 clone T14G11 map TEn5, complete sequence. | |||
| GenBank | AK221308 | 0.0 | AK221308.1 Arabidopsis thaliana mRNA for putative DOF zinc finger protein, complete cds, clone: RAFL25-04-B19. | |||
| GenBank | BT010496 | 0.0 | BT010496.1 Arabidopsis thaliana At2g34140 gene, complete cds. | |||
| GenBank | CP002685 | 0.0 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002881324.1 | 1e-128 | cyclic dof factor 4 | ||||
| Swissprot | O22967 | 1e-121 | CDF4_ARATH; Cyclic dof factor 4 | ||||
| TrEMBL | D7LGH3 | 1e-127 | D7LGH3_ARALL; Dof-type zinc finger domain-containing protein | ||||
| STRING | scaffold_401998.1 | 1e-127 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2809 | 26 | 69 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G34140.1 | 1e-106 | Dof family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 902497 |
| Entrez Gene | 9317391 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




