![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 914964 | ||||||||
| Common Name | ARALYDRAFT_914964 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 63aa MW: 7054.17 Da PI: 9.326 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 30.9 | 7.5e-10 | 3 | 49 | 53 | 99 |
DUF260 53 eredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99
e+++ + s +eA++r+ P+yG+vg+i+ lq+q++++k+e l+k+
914964 3 EQQQWVISSSFEAQCRIVGPIYGCVGIISLLQSQIQTKKNENLLAKT 49
4666777889*****************************99887776 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03195 | 1.8E-7 | 3 | 45 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 63 aa Download sequence Send to blast |
MKEQQQWVIS SSFEAQCRIV GPIYGCVGII SLLQSQIQTK KNENLLAKTN LVRTTLPNSY 60 FH* |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 914964 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| TrEMBL | D7MBX8 | 4e-38 | D7MBX8_ARALL; Uncharacterized protein | ||||
| STRING | scaffold_702706.1 | 6e-39 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM131 | 28 | 340 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G26620.1 | 4e-12 | LOB domain-containing protein 23 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 914964 |
| Entrez Gene | 9304130 |




