![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 918808 | ||||||||
| Common Name | ARALYDRAFT_918808 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 134aa MW: 14997 Da PI: 10.5127 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 46.9 | 9e-15 | 10 | 49 | 88 | 128 |
NAM 88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
+ k++++ +g+ vg+kk Lvfy g+apkg+kt+W+mheyrl
918808 10 NVKTITA-DGRRVGIKKALVFYAGKAPKGTKTNWIMHEYRL 49
4456666.9999***************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 18.372 | 1 | 82 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 8.5E-16 | 10 | 58 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.0E-6 | 15 | 49 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 134 aa Download sequence Send to blast |
MFDKPNQEKN VKTITADGRR VGIKKALVFY AGKAPKGTKT NWIMHEYRLI EHSRSHGSSK 60 KTSGSQRQAV TTPVQACREE HSTNGSSSSS SSQLDDVLDS FPEIKDQSFN LPRMNSLIYN 120 EVKKKIKEKI KNI* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3swm_A | 6e-21 | 12 | 60 | 108 | 156 | NAC domain-containing protein 19 |
| 3swm_B | 6e-21 | 12 | 60 | 108 | 156 | NAC domain-containing protein 19 |
| 3swm_C | 6e-21 | 12 | 60 | 108 | 156 | NAC domain-containing protein 19 |
| 3swm_D | 6e-21 | 12 | 60 | 108 | 156 | NAC domain-containing protein 19 |
| 3swp_A | 6e-21 | 12 | 60 | 108 | 156 | NAC domain-containing protein 19 |
| 3swp_B | 6e-21 | 12 | 60 | 108 | 156 | NAC domain-containing protein 19 |
| 3swp_C | 6e-21 | 12 | 60 | 108 | 156 | NAC domain-containing protein 19 |
| 3swp_D | 6e-21 | 12 | 60 | 108 | 156 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factors that bind specifically to the 5'-CATGTG-3' motif. {ECO:0000269|PubMed:15319476}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 918808 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Strongly induced by drought, high salinity and abscisic acid (ABA). Slightly up-regulated by cold treatment. Not induced by jasmonic acid. {ECO:0000269|PubMed:15319476, ECO:0000269|Ref.7}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF083738 | 1e-77 | AF083738.1 Arabidopsis thaliana clone sps433 unknown mRNA. | |||
| GenBank | AY087772 | 1e-77 | AY087772.1 Arabidopsis thaliana clone 38344 mRNA, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020871457.1 | 2e-72 | NAC domain-containing protein 72, partial | ||||
| Swissprot | Q93VY3 | 5e-61 | NAC72_ARATH; NAC domain-containing protein 72 | ||||
| TrEMBL | D7MLT1 | 2e-94 | D7MLT1_ARALL; Uncharacterized protein | ||||
| STRING | scaffold_802208.1 | 4e-95 | (Arabidopsis lyrata) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G27410.2 | 5e-62 | NAC family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 918808 |
| Entrez Gene | 9300540 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




