![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 9264 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 64aa MW: 7769.01 Da PI: 11.662 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 46.3 | 9.6e-15 | 14 | 58 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
r +WT E++++++a +++ + Wk+I ++g +Rt+ q++s+ qk+
9264 14 RAPWTRIEHDKFLRALELYDRD-WKRIETHVG-TRTAAQIRSHAQKH 58
569*****************77.*********.************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 1.94E-16 | 9 | 61 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 16.61 | 9 | 63 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.1E-9 | 10 | 63 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 9.4E-16 | 12 | 61 | IPR006447 | Myb domain, plants |
| SMART | SM00717 | 2.8E-11 | 13 | 61 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.2E-12 | 14 | 58 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 5.92E-8 | 16 | 59 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 64 aa Download sequence Send to blast |
SKKPRKPYVR TKTRAPWTRI EHDKFLRALE LYDRDWKRIE THVGTRTAAQ IRSHAQKHFL 60 KSVK |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator of evening element (EE)-containing clock-controlled genes. Forms a negative feedback loop with APRR5. Regulates the pattern of histone H3 acetylation of the TOC1 promoter. {ECO:0000269|PubMed:21205033, ECO:0000269|PubMed:21474993, ECO:0000269|PubMed:21483796, ECO:0000269|PubMed:23638299}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Circadian-regulation. Peak of expression in the afternoon. Down-regulated by cold. {ECO:0000269|PubMed:21205033, ECO:0000269|PubMed:22902701, ECO:0000269|PubMed:23638299}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CP000598 | 1e-103 | CP000598.1 Ostreococcus lucimarinus CCE9901 chromosome 18, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_001422340.1 | 5e-40 | predicted protein, partial | ||||
| Swissprot | Q8RWU3 | 5e-23 | RVE8_ARATH; Protein REVEILLE 8 | ||||
| TrEMBL | A4SA87 | 1e-38 | A4SA87_OSTLU; Uncharacterized protein (Fragment) | ||||
| STRING | ABP00657 | 2e-39 | (Ostreococcus 'lucimarinus') | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Chlorophytae | OGCP454 | 14 | 27 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G09600.2 | 2e-25 | MYB_related family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 9264 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




