![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 93174 | ||||||||
| Common Name | MADS9-1, SELMODRAFT_450769 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 60aa MW: 7038.29 Da PI: 10.7863 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 44.4 | 2.1e-14 | 17 | 54 | 9 | 46 |
HHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
SRF-TF 9 rqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
r+ tf kR +g++KKA EL vLC+a+v v ++ +gk
93174 17 RTQTFRKRTEGLFKKAIELQVLCGAKVEVTVIYDSGKK 54
778*********************98877666666554 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 19.764 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.1E-13 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 6.15E-19 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00120 | 2.59E-15 | 2 | 60 | No hit | No description |
| PRINTS | PR00404 | 5.3E-12 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 5.4E-14 | 16 | 55 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.3E-12 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.3E-12 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 60 aa Download sequence Send to blast |
MGRRKIDIKY LVKNNPRTQT FRKRTEGLFK KAIELQVLCG AKVEVTVIYD SGKKHFFYSS |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002970519.1 | 1e-37 | serum factor response D | ||||
| Refseq | XP_002978603.1 | 1e-37 | serum factor response D | ||||
| TrEMBL | D8RGU6 | 3e-36 | D8RGU6_SELML; MADS-domain transcription factor | ||||
| TrEMBL | D8S5G0 | 2e-36 | D8S5G0_SELML; MADS-domain transcription factor | ||||
| STRING | EFJ20589 | 4e-37 | (Selaginella moellendorffii) | ||||
| STRING | EFJ28649 | 5e-37 | (Selaginella moellendorffii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP16 | 17 | 761 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G13790.1 | 9e-12 | AGAMOUS-like 15 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 93174 |
| Entrez Gene | 9631738 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




