![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 9595 | ||||||||
| Common Name | MADS15-2, SELMODRAFT_450775 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 57aa MW: 6319.56 Da PI: 11.1385 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 70.9 | 1.1e-22 | 9 | 56 | 1 | 48 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
k+ien s rqv fskRr g++KKA+ELS+LC+ ev +i+fs+ gk +
9595 9 KKIENRSARQVCFSKRRMGLIKKASELSILCGSEVGIIVFSQAGKAFS 56
78******************************************9765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 27.249 | 1 | 57 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 7.85E-24 | 1 | 57 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.2E-26 | 1 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.2E-23 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 8.5E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.2E-23 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.2E-23 | 38 | 57 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 57 aa Download sequence Send to blast |
MGRAKIEIKK IENRSARQVC FSKRRMGLIK KASELSILCG SEVGIIVFSQ AGKAFSF |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in the developmental regulation of the endothelium and in the accumulation of proanthocyanidins (PAs) or condensed tannins which give the seed its brown pigmentation after oxidation (PubMed:12368498, PubMed:16080001). Necessary for the normal activation of the BANYULS promoter in the endothelium body (PubMed:12368498). Is required, together with AGL11/STK for the maternal control of endothelium formation, which is essential for female gametophyte development and fertilization, and seed formation (PubMed:22176531). Interacts genetically with AGL1/SHP1 and AGL5/SHP2 in a partially antagonistic manner and represses AGL1/SHP1, AGL5/SHP2, and AGL8/FUL during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). Mediates the crosstalk between endothelium and nucellus to ensure proper seed formation. Functions redundantly with AGL63/GOA to repress nucellus growth and promote its degeneration. Represses the negative regulator of autophagy and programmed cell death HVA22D in the proximal nucellus (PubMed:27233529). Binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:16080001). {ECO:0000269|PubMed:12368498, ECO:0000269|PubMed:16080001, ECO:0000269|PubMed:22176531, ECO:0000269|PubMed:27233529, ECO:0000269|PubMed:27776173}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024534891.1 | 2e-32 | agamous-like MADS-box protein AGL28 | ||||
| Swissprot | Q8RYD9 | 4e-21 | TT16_ARATH; Protein TRANSPARENT TESTA 16 | ||||
| TrEMBL | D8SQX2 | 2e-30 | D8SQX2_SELML; MADS-domain transcription factor | ||||
| TrEMBL | D8TG70 | 2e-30 | D8TG70_SELML; Type I MADS-domain transcription factor | ||||
| STRING | EFJ04345 | 4e-31 | (Selaginella moellendorffii) | ||||
| STRING | EFJ13243 | 3e-31 | (Selaginella moellendorffii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP16 | 17 | 761 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G23260.3 | 1e-23 | MIKC_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 9595 |
| Entrez Gene | 9653610 |




