PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information? help Back to Top

TF ID

9704

Organism

Taxonomic ID

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus

Family

Protein Properties

Length: 66aa MW: 7872.05 Da PI: 9.8882

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
9704	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	106.9	1.1e-33	11	66	2	57
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrk 57 ++ a++cprC+s++tkfCyynny+++qPr++Ck+C ryWt+GG+lrnv vG+grrk 9704 11 PDYAVACPRCKSDDTKFCYYNNYNIKQPRFYCKKCCRYWTEGGSLRNVRVGAGRRK 66 677899*************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	9.0E-20	1	66	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	3.1E-28	14	66	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	25.574	15	66	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	17	53	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 66 aa Download sequence Send to blast
DEKKREPLPK PDYAVACPRC KSDDTKFCYY NNYNIKQPRF YCKKCCRYWT EGGSLRNVRV 60 GAGRRK

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	CP000584	1e-106	CP000584.1 Ostreococcus lucimarinus CCE9901 chromosome 4, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_001417524.1	5e-42	predicted protein, partial
Swissprot	Q8LAP8	3e-26	DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBL	A4RW53	1e-40	A4RW53_OSTLU; Uncharacterized protein (Fragment)
STRING	ABO95817	2e-41	(Ostreococcus 'lucimarinus')

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Chlorophytae	OGCP4655	11	11

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G24060.1	1e-28	Dof family protein

Link Out ? help Back to Top
Phytozome	9704

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]