![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 9763 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 65aa MW: 7445.72 Da PI: 11.0233 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 28 | 4.7e-09 | 1 | 55 | 8 | 62 |
HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62
rrk+ NRe+A+rs RKkae ++L +++L + +++k++ l+k+v++l +e
9763 1 RRKIANRESAKRSKIRKKAEDAKLLSAAETLLQDSASMRKTITDLQKKVDTLYAE 55
8************************************************999776 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.20.5.170 | 1.0E-8 | 1 | 52 | No hit | No description |
| SuperFamily | SSF57959 | 1.75E-6 | 1 | 53 | No hit | No description |
| PROSITE profile | PS50217 | 9.347 | 1 | 59 | IPR004827 | Basic-leucine zipper domain |
| SMART | SM00338 | 0.0019 | 1 | 58 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 7.9E-8 | 1 | 55 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 65 aa Download sequence Send to blast |
RRKIANRESA KRSKIRKKAE DAKLLSAAET LLQDSASMRK TITDLQKKVD TLYAENVKLR 60 MKLGE |
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CP000584 | 1e-105 | CP000584.1 Ostreococcus lucimarinus CCE9901 chromosome 4, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_001417196.1 | 1e-37 | predicted protein, partial | ||||
| TrEMBL | A4RVS1 | 3e-36 | A4RVS1_OSTLU; Uncharacterized protein (Fragment) | ||||
| STRING | ABO95489 | 5e-37 | (Ostreococcus 'lucimarinus') | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Chlorophytae | OGCP9223 | 4 | 4 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G32150.1 | 9e-12 | basic region/leucine zipper transcription factor 68 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 9763 |




