PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

99671

Common Name

SELMODRAFT_99671

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

Nin-like

Protein Properties

Length: 58aa MW: 6433.61 Da PI: 10.7154

Description

Nin-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
99671	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	RWP-RK	78.6	6.6e-25	3	50	4	51
RWP-RK 4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51 ++ l+dls+yF+l+i dAAk+Lgv++T+LK++CR++G+kRWP Rk+ + 99671 3 HLILSDLSAYFHLSIVDAAKKLGVSQTTLKKACRKFGLKRWPGRKVDQ 50 6889*****************************************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51071	9.569	1	57	IPR000281	Helix-turn-helix protein RpiR
PROSITE profile	PS51519	15.971	1	57	IPR003035	RWP-RK domain
SuperFamily	SSF46689	4.06E-6	3	45	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.10	8.7E-7	4	44	IPR011991	Winged helix-turn-helix DNA-binding domain
Pfam	PF01418	2.3E-6	4	44	IPR000281	Helix-turn-helix protein RpiR
Pfam	PF02042	1.2E-21	4	50	IPR003035	RWP-RK domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 58 aa Download sequence Send to blast
THHLILSDLS AYFHLSIVDA AKKLGVSQTT LKKACRKFGL KRWPGRKVDQ LELISLT*

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002975726.2	7e-29	uncharacterized protein LOC9630378
TrEMBL	D8RR43	4e-33	D8RR43_SELML; Uncharacterized protein (Fragment)
STRING	EFJ25331	6e-34	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP567	17	77

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G35590.1	5e-13	RWP-RK domain-containing protein

Link Out ? help Back to Top
Phytozome	99671
Entrez Gene	9642150

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031]