![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AA13G00088 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 129aa MW: 14979.1 Da PI: 10.0651 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 61.1 | 2.3e-19 | 10 | 55 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+g+W+ eEde+l ++v+++G+++W+ I+ ++ gR++k+c++rw +
AA13G00088 10 KGPWSREEDEQLQELVEKHGPKNWSVISGLIP-GRSPKSCRLRWCNQ 55
79******************************.***********985 PP
| |||||||
| 2 | Myb_DNA-binding | 48.2 | 2.5e-15 | 64 | 106 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+WT+eEd++++++ ++lG++ W+ Iar + R+++ +k+rw++
AA13G00088 64 PWTAEEDQIIIRGRAELGNR-WAVIARSLH-LRSDNAVKNRWNST 106
8*******************.*********.9**********986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 24.881 | 5 | 60 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 1.22E-30 | 8 | 103 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 6.2E-17 | 9 | 58 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 7.1E-19 | 10 | 55 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.1E-26 | 11 | 63 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.50E-14 | 12 | 54 | No hit | No description |
| SMART | SM00717 | 1.5E-14 | 61 | 109 | IPR001005 | SANT/Myb domain |
| PROSITE profile | PS51294 | 17.183 | 61 | 111 | IPR017930 | Myb domain |
| CDD | cd00167 | 1.51E-10 | 64 | 107 | No hit | No description |
| Pfam | PF00249 | 9.7E-14 | 64 | 106 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.0E-21 | 64 | 110 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 129 aa Download sequence Send to blast |
MCTLTVEAVK GPWSREEDEQ LQELVEKHGP KNWSVISGLI PGRSPKSCRL RWCNQLSPEV 60 KHRPWTAEED QIIIRGRAEL GNRWAVIARS LHLRSDNAVK NRWNSTLKRQ FRLSRCNVDN 120 LMSFDLSNT |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1gv2_A | 8e-37 | 7 | 111 | 1 | 105 | MYB PROTO-ONCOGENE PROTEIN |
| 1h88_C | 2e-36 | 3 | 111 | 51 | 159 | MYB PROTO-ONCOGENE PROTEIN |
| 1h89_C | 2e-36 | 3 | 111 | 51 | 159 | MYB PROTO-ONCOGENE PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AA13G00088 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009136534.1 | 1e-50 | PREDICTED: transcription factor MYB44-like | ||||
| Refseq | XP_013593223.1 | 2e-50 | PREDICTED: transcription factor MYB44-like | ||||
| Swissprot | Q9SN12 | 1e-49 | MYB77_ARATH; Transcription factor MYB77 | ||||
| TrEMBL | A0A0D3DDR7 | 4e-49 | A0A0D3DDR7_BRAOL; Uncharacterized protein | ||||
| TrEMBL | A0A398A3P3 | 4e-49 | A0A398A3P3_BRACM; Uncharacterized protein | ||||
| TrEMBL | A0A3P6ABV8 | 4e-49 | A0A3P6ABV8_BRACM; Uncharacterized protein | ||||
| TrEMBL | A0A3P6EXG6 | 4e-49 | A0A3P6EXG6_BRAOL; Uncharacterized protein | ||||
| TrEMBL | M4D8V0 | 3e-49 | M4D8V0_BRARP; Uncharacterized protein | ||||
| STRING | Bra012910.1-P | 6e-50 | (Brassica rapa) | ||||
| STRING | Bo7g099180.1 | 6e-50 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM677 | 28 | 135 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G50060.1 | 6e-52 | myb domain protein 77 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




