PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AA167G00006

Organism

Aethionema arabicum

Taxonomic ID

228871

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema

Family

BES1

Protein Properties

Length: 127aa MW: 14306.2 Da PI: 10.7049

Description

BES1 family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AA167G00006	genome	VEGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF822	159.6	2.1e-49	10	82	1	73
DUF822 1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgs 73 ++++rkp+w+ErEnn+rRERrRRa+aakiy+GLRaqGny+lpk++DnneVlkALc+eAGwvve+DGttyrk AA167G00006 10 AAARRKPSWRERENNRRRERRRRAVAAKIYSGLRAQGNYNLPKHCDNNEVLKALCAEAGWVVEEDGTTYRKNV 82 5899******************************************************************976 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF05687	1.5E-45	12	95	IPR008540	BES1/BZR1 plant transcription factor, N-terminal

Sequence ? help Back to Top
Protein Sequence Length: 127 aa Download sequence Send to blast
MTSDGATLAA AARRKPSWRE RENNRRRERR RRAVAAKIYS GLRAQGNYNL PKHCDNNEVL 60 KALCAEAGWV VEEDGTTYRK NVIITSAGSW KLVGFGFAVS AAQAGNLDNR KMDLLNYGRK 120 MEFSIRD

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5zd4_A	4e-28	13	80	371	438	Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_B	4e-28	13	80	371	438	Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_C	4e-28	13	80	371	438	Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_D	4e-28	13	80	371	438	Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
Search in ModeBase

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	12	31	RRKPSWRERENNRRRERRRR

Functional Description ? help Back to Top
Source	Description
UniProt	Positive regulator of brassinosteroid (BR) signaling. Transcription factor that activates target gene expression by binding specifically to the DNA sequence 5'-CANNTG-3'(E box) through its N-terminal domain. Can bind individually to the promoter as a homodimer or synergistically as a heterodimer with BIM1, BIM2 or BIM3. The C-terminal domain is probably involved in transcriptional activation (PubMed:12007405, PubMed:15680330, PubMed:18467490, PubMed:19170933). Recruits the transcription elongation factor IWS1 to control BR-regulated gene expression (PubMed:20139304). Forms a trimeric complex with IWS1 and ASHH2/SDG8 to regulate BR-regulated gene expression (PubMed:24838002). Promotes quiescent center (QC) self-renewal by cell divisions in the primary root. Binds to the E-boxes of the BRAVO promoter to repress its expression (PubMed:24981610). {ECO:0000269\|PubMed:12007405, ECO:0000269\|PubMed:15680330, ECO:0000269\|PubMed:18467490, ECO:0000269\|PubMed:19170933, ECO:0000269\|PubMed:20139304, ECO:0000269\|PubMed:24838002, ECO:0000269\|PubMed:24981610}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AA167G00006

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020219169.1	9e-37	protein BRASSINAZOLE-RESISTANT 1
Swissprot	Q9LN63	3e-32	BZR2_ARATH; Protein BRASSINAZOLE-RESISTANT 2
TrEMBL	A0A218WPU9	2e-35	A0A218WPU9_PUNGR; Uncharacterized protein
STRING	XP_006473462.1	6e-36	(Citrus sinensis)
STRING	EOY14691	7e-36	(Theobroma cacao)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM15511	11	17

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G19350.6	5e-34	BES1 family protein

Publications ? help Back to Top
Salazar-Henao JE,Lehner R,Betegón-Putze I,Vilarrasa-Blasi J,Caño-Delgado AI BES1 regulates the localization of the brassinosteroid receptor BRL3 within the provascular tissue of the Arabidopsis primary root. J. Exp. Bot., 2016. 67(17): p. 4951-61 [PMID:27511026] Nolan T, et al. Identification of Brassinosteroid Target Genes by Chromatin Immunoprecipitation Followed by High-Throughput Sequencing (ChIP-seq) and RNA-Sequencing. Methods Mol. Biol., 2017. 1564: p. 63-79 [PMID:28124247] Ye H, et al. RD26 mediates crosstalk between drought and brassinosteroid signalling pathways. Nat Commun, 2017. 8: p. 14573 [PMID:28233777] Nolan TM, et al. Selective Autophagy of BES1 Mediated by DSK2 Balances Plant Growth and Survival. Dev. Cell, 2017. 41(1): p. 33-46.e7 [PMID:28399398] Yang M, et al. SINAT E3 Ligases Control the Light-Mediated Stability of the Brassinosteroid-Activated Transcription Factor BES1 in Arabidopsis. Dev. Cell, 2017. 41(1): p. 47-58.e4 [PMID:28399399] Chen J, et al. Arabidopsis WRKY46, WRKY54, and WRKY70 Transcription Factors Are Involved in Brassinosteroid-Regulated Plant Growth and Drought Responses. Plant Cell, 2017. 29(6): p. 1425-1439 [PMID:28576847] Yang M,Wang X Multiple Ways of BES1/BZR1 Degradation to Decode Distinct Developmental and Environmental Cues in Plants. Mol Plant, 2017. 10(7): p. 915-917 [PMID:28629641] Saito M,Kondo Y,Fukuda H BES1 and BZR1 Redundantly Promote Phloem and Xylem Differentiation. Plant Cell Physiol., 2018. 59(3): p. 590-600 [PMID:29385529] Liang T, et al. UVR8 Interacts with BES1 and BIM1 to Regulate Transcription and Photomorphogenesis in Arabidopsis. Dev. Cell, 2018. 44(4): p. 512-523.e5 [PMID:29398622]