PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AA30G00169

Organism

Aethionema arabicum

Taxonomic ID

228871

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema

Family

M-type_MADS

Protein Properties

Length: 88aa MW: 10238 Da PI: 10.5733

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AA30G00169	genome	VEGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	63.8	1.8e-20	3	47	5	49
SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 ksn vt+s+R+ gi+KKA+E ++LC+++++vi+fs++gk++ + AA30G00169 3 KKSNLLVTYSRRKSGIFKKASEFCTLCGVQILVILFSPSGKIFSF 47 588999***********************************9987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.9E-14	1	50	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	17.563	1	51	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.19E-20	3	70	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.8E-20	3	47	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.9E-8	13	28	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.9E-8	28	49	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MNKKSNLLVT YSRRKSGIFK KASEFCTLCG VQILVILFSP SGKIFSFGHP NVRDRIDYFL 60 NRNYNHQFDV AILDLQKIKK LNDQLTKI

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269\|PubMed:18334668}.
UniProt	Probable transcription factor that controls female gametophyte (megagametogenesis) development and chloroplast biogenesis during embryo development. {ECO:0000269\|PubMed:18346189}.
UniProt	Probable transcription factor that may function as a floral promoter operating upstream of known floral activators in the autonomous pathway. {ECO:0000269\|PubMed:16899218}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AA30G00169

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016581988.1	8e-27	PREDICTED: agamous-like MADS-box protein AGL62
Refseq	XP_016581993.1	8e-27	PREDICTED: agamous-like MADS-box protein AGL62
Swissprot	O80807	3e-23	AGL23_ARATH; Agamous-like MADS-box protein AGL23
Swissprot	Q9FKK2	5e-23	AGL62_ARATH; Agamous-like MADS-box protein AGL62
Swissprot	Q9LMM8	4e-23	AGL28_ARATH; Agamous-like MADS-box protein AGL28
TrEMBL	A0A1U8HL60	2e-25	A0A1U8HL60_CAPAN; agamous-like MADS-box protein AGL62
TrEMBL	A0A1U8HL64	2e-25	A0A1U8HL64_CAPAN; Agamous-like MADS-box protein AGL62
TrEMBL	A0A2G2UY02	6e-26	A0A2G2UY02_CAPBA; Agamous-like MADS-box protein AGL62
STRING	XP_009792225.1	1e-25	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM86	28	390

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G65360.1	1e-25	AGAMOUS-like 23

Publications ? help Back to Top
Xu W, et al. Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds. Plant Cell, 2016. 28(6): p. 1343-60 [PMID:27233529] Figueiredo DD,Batista RA,Roszak PJ,Köhler C Auxin production couples endosperm development to fertilization. Nat Plants, 2015. 1: p. 15184 [PMID:27251719] Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C Auxin production in the endosperm drives seed coat development in Arabidopsis. Elife, 2017. [PMID:27848912] Fiume E,Coen O,Xu W,Lepiniec L,Magnani E Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal. Plant Signal Behav, 2017. 12(8): p. e1339000 [PMID:28613109] Cheng JZ,Zhou YP,Lv TX,Xie CP,Tian CE Research progress on the autonomous flowering time pathway in Arabidopsis. Physiol Mol Biol Plants, 2017. 23(3): p. 477-485 [PMID:28878488] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]