![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AA37G00119 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 106aa MW: 12174.2 Da PI: 10.7077 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 105.8 | 2.4e-33 | 26 | 80 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
kprlrWt eLH+rFv av+qLGG++kAtPkti+++m vkgLtl+h+kSHLQk+R+
AA37G00119 26 KPRLRWTVELHQRFVYAVTQLGGPNKATPKTIMRVMRVKGLTLYHLKSHLQKFRS 80
79****************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 11.368 | 23 | 83 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 2.0E-31 | 23 | 80 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.13E-16 | 25 | 81 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 1.4E-23 | 26 | 81 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 9.7E-7 | 28 | 78 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 106 aa Download sequence Send to blast |
MLEDENIKRS MCVQDDSGLV LTTDPKPRLR WTVELHQRFV YAVTQLGGPN KATPKTIMRV 60 MRVKGLTLYH LKSHLQKFRS GKQPHKDYTK DCPRASSSGN MISRSM |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6j4r_A | 8e-21 | 26 | 82 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_B | 8e-21 | 26 | 82 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_C | 8e-21 | 26 | 82 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_D | 8e-21 | 26 | 82 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor required for phloem identity. Has a dual role both in promoting phloem differentiation and in repressing xylem differentiation during vascular development. Regulates the expression of the transcription factor NAC045 (AC A4VCM0). May activate the transcription of specific genes involved in phosphate uptake or assimilation (PubMed:15592750). Promotes flowering through transcriptional activation of both FT and its transport machinery component, FTIP1 (PubMed:26239308). {ECO:0000269|PubMed:14614507, ECO:0000269|PubMed:18523061, ECO:0000269|PubMed:25081480, ECO:0000269|PubMed:26239308, ECO:0000305|PubMed:15592750}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AA37G00119 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated by phosphate deficiency. {ECO:0000269|PubMed:15592750}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009106664.1 | 8e-48 | PREDICTED: myb family transcription factor APL | ||||
| Refseq | XP_013589860.1 | 7e-48 | PREDICTED: myb family transcription factor APL | ||||
| Refseq | XP_013650277.1 | 7e-48 | myb family transcription factor APL | ||||
| Refseq | XP_013726973.1 | 7e-48 | myb family transcription factor APL | ||||
| Refseq | XP_022545127.1 | 7e-50 | myb family transcription factor APL-like | ||||
| Swissprot | Q9SAK5 | 1e-48 | APL_ARATH; Myb family transcription factor APL | ||||
| TrEMBL | A0A078J370 | 6e-48 | A0A078J370_BRANA; BnaA02g36130D protein | ||||
| TrEMBL | A0A397YV04 | 2e-47 | A0A397YV04_BRACM; Uncharacterized protein (Fragment) | ||||
| STRING | XP_004173831.1 | 9e-50 | (Cucumis sativus) | ||||
| STRING | Bostr.20129s0378.1.p | 2e-47 | (Boechera stricta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM363 | 28 | 184 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G79430.2 | 5e-51 | G2-like family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




