PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AA3G00292

Organism

Aethionema arabicum

Taxonomic ID

228871

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema

Family

MYB_related

Protein Properties

Length: 138aa MW: 15550.6 Da PI: 5.7464

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AA3G00292	genome	VEGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	48.5	2e-15	36	78	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +W++ E ++l++av +G + Wk++a +++ g+++k+c+s++ k+ AA3G00292 36 KWSEKETLQLLEAVMHYGDD-WKKVAPHVP-GKSDKECVSHFIKL 78 8***************88.*****.*********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51293	19.599	32	83	IPR017884	SANT domain
SMART	SM00717	1.1E-12	33	81	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.6E-11	33	77	IPR009057	Homeodomain-like
SuperFamily	SSF46689	6.5E-14	33	86	IPR009057	Homeodomain-like
Pfam	PF00249	1.0E-14	35	78	IPR001005	SANT/Myb domain
CDD	cd00167	3.08E-11	36	78	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 138 aa Download sequence Send to blast
YELTLCARCY VRGNYRVGIN SSEFKRVELS EESKAKWSEK ETLQLLEAVM HYGDDWKKVA 60 PHVPGKSDKE CVSHFIKLPF GEQFLKESES EGALETLDQI KDSPPISESG ERCKDGSSPI 120 KRMKLTPLAD ASNPIMAQ

Functional Description ? help Back to Top
Source	Description
UniProt	Component of a multiprotein complex equivalent of the SWI/SNF complex, an ATP-dependent chromatin-remodeling complex, which is required for the positive and negative regulation of gene expression of a large number of genes. It changes chromatin structure by altering DNA-histone contacts within a nucleosome, leading eventually to a change in nucleosome position, thus facilitating or repressing binding of gene-specific transcription factors. May play an essential role in the transition from the vegetative to the reproductive phase of development. May be a positive regulator of ABA signaling. {ECO:0000269\|PubMed:12140326, ECO:0000269\|PubMed:14682613, ECO:0000269\|PubMed:16055636, ECO:0000269\|PubMed:19033529}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AA3G00292

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006294152.1	6e-73	SWI/SNF complex subunit SWI3B isoform X1
Swissprot	Q84JG2	4e-69	SWI3B_ARATH; SWI/SNF complex subunit SWI3B
TrEMBL	R0HP64	1e-71	R0HP64_9BRAS; Uncharacterized protein
STRING	Bostr.23794s0739.1.p	4e-73	(Boechera stricta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM9403	2	3

Publications ? help Back to Top
Sarnowski TJ,Swiezewski S,Pawlikowska K,Kaczanowski S,Jerzmanowski A AtSWI3B, an Arabidopsis homolog of SWI3, a core subunit of yeast Swi/Snf chromatin remodeling complex, interacts with FCA, a regulator of flowering time. Nucleic Acids Res., 2002. 30(15): p. 3412-21 [PMID:12140326] Zhou C,Miki B,Wu K CHB2, a member of the SWI3 gene family, is a global regulator in Arabidopsis. Plant Mol. Biol., 2003. 52(6): p. 1125-34 [PMID:14682613] Sarnowski TJ, et al. SWI3 subunits of putative SWI/SNF chromatin-remodeling complexes play distinct roles during Arabidopsis development. Plant Cell, 2005. 17(9): p. 2454-72 [PMID:16055636] Archacki R, et al. Genetic analysis of functional redundancy of BRM ATPase and ATSWI3C subunits of Arabidopsis SWI/SNF chromatin remodelling complexes. Planta, 2009. 229(6): p. 1281-92 [PMID:19301030] Zhu Y,Rowley MJ,Böhmdorfer G,Wierzbicki AT A SWI/SNF chromatin-remodeling complex acts in noncoding RNA-mediated transcriptional silencing. Mol. Cell, 2013. 49(2): p. 298-309 [PMID:23246435] Liu ZW, et al. Two Components of the RNA-Directed DNA Methylation Pathway Associate with MORC6 and Silence Loci Targeted by MORC6 in Arabidopsis. PLoS Genet., 2016. 12(5): p. e1006026 [PMID:27171427] Han W, et al. The SWI/SNF subunit SWI3B regulates IAMT1 expression via chromatin remodeling in Arabidopsis leaf development. Plant Sci., 2018. 271: p. 127-132 [PMID:29650150]