![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AA46G00155 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 78aa MW: 9051.32 Da PI: 6.7912 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 52.7 | 5.4e-17 | 1 | 31 | 21 | 51 |
HHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 21 lKKAeELSvLCdaevaviifsstgklyeyss 51
+KKA+ELS+LCdaeva+iifs+t+kly+++s
AA46G00155 1 MKKAKELSILCDAEVALIIFSNTNKLYDFAS 31
8****************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF00319 | 5.6E-13 | 1 | 29 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 6.7E-5 | 1 | 32 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 9.81E-18 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 16.287 | 1 | 33 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 78 aa Download sequence Send to blast |
MKKAKELSIL CDAEVALIIF SNTNKLYDFA SSSMKSTIEK FNNTKIEQQQ LLDPAAEAKF 60 WQREVTNLRH ELHTLHEN |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AA46G00155 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013603502.1 | 2e-39 | PREDICTED: agamous-like MADS-box protein AGL17 | ||||
| Swissprot | Q9SZJ6 | 3e-37 | AGL21_ARATH; Agamous-like MADS-box protein AGL21 | ||||
| TrEMBL | A0A1J3DYU8 | 4e-39 | A0A1J3DYU8_NOCCA; Agamous-like MADS-box protein AGL17 | ||||
| TrEMBL | A0A1J3IXG4 | 3e-39 | A0A1J3IXG4_NOCCA; Agamous-like MADS-box protein AGL17 (Fragment) | ||||
| STRING | Bra039921.1-P | 2e-38 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM78 | 28 | 413 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G37940.1 | 1e-39 | AGAMOUS-like 21 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




