![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AA4G00115 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 54aa MW: 6315.09 Da PI: 4.605 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 57 | 6.5e-18 | 7 | 53 | 1 | 48 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
lp+GfrFhPtdeelv++yL+++++++++++ vi+e+d+yk++Pw+Lp
AA4G00115 7 LPAGFRFHPTDEELVKFYLCRRCASEPISV-PVIAEIDLYKFNPWELP 53
799***************************.89**************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 6.28E-19 | 3 | 53 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 21.019 | 7 | 54 | IPR003441 | NAC domain |
| Pfam | PF02365 | 8.4E-8 | 8 | 48 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 54 aa Download sequence Send to blast |
MKAELDLPAG FRFHPTDEEL VKFYLCRRCA SEPISVPVIA EIDLYKFNPW ELPX |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 4e-21 | 2 | 53 | 10 | 61 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | May be involved in regulation of seed germination under flooding. {ECO:0000269|PubMed:19176720}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AA4G00115 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By low-oxygen stress. {ECO:0000269|PubMed:19176720}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018439406.1 | 9e-31 | PREDICTED: NAC domain-containing protein 102-like | ||||
| Refseq | XP_018439407.1 | 9e-31 | PREDICTED: NAC domain-containing protein 102-like | ||||
| Swissprot | Q8H115 | 5e-31 | NA102_ARATH; NAC domain-containing protein 102 | ||||
| TrEMBL | A0A398AGK8 | 1e-29 | A0A398AGK8_BRACM; Uncharacterized protein | ||||
| STRING | Bra029201.1-P | 3e-30 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM7967 | 13 | 40 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G63790.1 | 2e-33 | NAC domain containing protein 102 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




