![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AA4G00238 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 63aa MW: 7002.79 Da PI: 11.0568 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 72.9 | 2.7e-23 | 9 | 56 | 1 | 48 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
krienks rqvtfskRrng++ KA LSvLC+ vav+++s tgkly
AA4G00238 9 KRIENKSSRQVTFSKRRNGLIEKARQLSVLCESSVAVLVVSATGKLYN 56
79********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF55455 | 1.44E-24 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 28.217 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 3.4E-32 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.3E-24 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.7E-22 | 10 | 55 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.3E-24 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.3E-24 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 63 aa Download sequence Send to blast |
MGRRKVEIKR IENKSSRQVT FSKRRNGLIE KARQLSVLCE SSVAVLVVSA TGKLYNSSSG 60 DDX |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 9e-17 | 1 | 61 | 1 | 61 | MEF2C |
| 5f28_B | 9e-17 | 1 | 61 | 1 | 61 | MEF2C |
| 5f28_C | 9e-17 | 1 | 61 | 1 | 61 | MEF2C |
| 5f28_D | 9e-17 | 1 | 61 | 1 | 61 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that prevents vernalization by short periods of cold. Acts as a floral repressor. {ECO:0000269|PubMed:12724541, ECO:0000269|PubMed:19139056, ECO:0000269|PubMed:20551443}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AA4G00238 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Requires EARLY FLOWERING 7 (ELF7) and ELF8 to be expressed. Up-regulated by HUA2. {ECO:0000269|PubMed:15520273, ECO:0000269|PubMed:15659097}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009150584.1 | 8e-34 | PREDICTED: agamous-like MADS-box protein AGL27 isoform X1 | ||||
| Refseq | XP_009150585.1 | 8e-34 | PREDICTED: agamous-like MADS-box protein AGL27 isoform X2 | ||||
| Refseq | XP_024007051.1 | 8e-34 | LOW QUALITY PROTEIN: agamous-like MADS-box protein AGL27 | ||||
| Swissprot | Q9FPN7 | 2e-32 | AGL31_ARATH; Agamous-like MADS-box protein AGL31 | ||||
| TrEMBL | A0A3N6RWK1 | 1e-32 | A0A3N6RWK1_BRACR; Uncharacterized protein (Fragment) | ||||
| STRING | Bra024350.1-P | 3e-33 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM78 | 28 | 413 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G65050.2 | 2e-35 | AGAMOUS-like 31 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




