PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AA53G01118

Organism

Aethionema arabicum

Taxonomic ID

228871

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema

Family

MYB_related

Protein Properties

Length: 82aa MW: 9616.26 Da PI: 10.6817

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AA53G01118	genome	VEGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	54.1	3.5e-17	10	57	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT +Ed ll +++ q+G g W+ ++r+ g++R++k+c++rw++yl AA53G01118 10 KGAWTVDEDNLLRHCIDQYGEGKWHQVPRRTGLNRCRKSCRLRWLNYL 57 79*********************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.2E-22	3	60	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.84	5	61	IPR017930	Myb domain
SMART	SM00717	6.8E-14	9	59	IPR001005	SANT/Myb domain
Pfam	PF00249	1.4E-15	10	57	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	9.79E-21	11	82	IPR009057	Homeodomain-like
CDD	cd00167	3.18E-10	12	57	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.2E-6	61	82	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 82 aa Download sequence Send to blast
MKVPSKGLTK GAWTVDEDNL LRHCIDQYGE GKWHQVPRRT GLNRCRKSCR LRWLNYLKPN 60 IKKGKFSSDE VDLLLRLHKL LG

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1, or BHLH042/TT8. {ECO:0000269\|PubMed:15361138}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AA53G01118

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF062908	9e-62	AF062908.1 Arabidopsis thaliana putative transcription factor (MYB75) mRNA, complete cds.
GenBank	AK221639	9e-62	AK221639.1 Arabidopsis thaliana mRNA for transcription factor, complete cds, clone: RAFL07-99-A21.
GenBank	AY519563	9e-62	AY519563.1 Arabidopsis thaliana MYB transcription factor (At1g56650) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010511463.1	3e-42	PREDICTED: transcription factor MYB114-like
Refseq	XP_022545155.1	2e-42	transcription factor MYB114-like
Swissprot	Q9FNV9	1e-39	MY113_ARATH; Transcription factor MYB113
TrEMBL	A0A089G5X7	6e-41	A0A089G5X7_BRACM; Anthocyanin R2R3-MYB transcription factor
TrEMBL	A0A0D3CYD9	1e-40	A0A0D3CYD9_BRAOL; Uncharacterized protein
TrEMBL	A0A0H3XWN6	1e-40	A0A0H3XWN6_RAPSA; Anthocyanin regulator
TrEMBL	A0A3P6GC00	1e-40	A0A3P6GC00_BRAOL; Uncharacterized protein
TrEMBL	E5D8F4	1e-40	E5D8F4_BRAOB; MYB2
STRING	XP_010470514.1	2e-41	(Camelina sativa)
STRING	XP_010511463.1	1e-41	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G66370.1	6e-42	myb domain protein 113

Publications ? help Back to Top
Li T, et al. Jasmonic acid enhancement of anthocyanin accumulation is dependent on phytochrome A signaling pathway under far-red light in Arabidopsis. Biochem. Biophys. Res. Commun., 2014. 454(1): p. 78-83 [PMID:25450360] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275]