PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AA54G00400

Organism

Aethionema arabicum

Taxonomic ID

228871

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema

Family

WRKY

Protein Properties

Length: 147aa MW: 16494.7 Da PI: 9.833

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AA54G00400	genome	VEGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	109	2.2e-34	10	67	2	59
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +Dgy+WrKYGqK vk+s fprsYYrCt+++C+vkk+vers +dp+vv++tY+g+Hnh+ AA54G00400 10 EDGYRWRKYGQKAVKNSSFPRSYYRCTTQKCNVKKRVERSFQDPTVVITTYQGKHNHP 67 8********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	3.1E-33	2	69	IPR003657	WRKY domain
SuperFamily	SSF118290	1.57E-29	3	69	IPR003657	WRKY domain
PROSITE profile	PS50811	31.433	4	69	IPR003657	WRKY domain
SMART	SM00774	2.2E-38	9	68	IPR003657	WRKY domain
Pfam	PF03106	1.8E-26	10	67	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 147 aa Download sequence Send to blast
MTKSEIDHLE DGYRWRKYGQ KAVKNSSFPR SYYRCTTQKC NVKKRVERSF QDPTVVITTY 60 QGKHNHPIPT TLRGSVAGAG IFPQPFYPAG GVNSIFSMHH NNPPVNYAAM GSIPYGEVHG 120 NSGGHKQVVD YGLLQDIVPS MFLKHEP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	2e-28	1	69	9	77	Probable WRKY transcription factor 4
2lex_A	2e-28	1	69	9	77	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00168	DAP	Transfer from AT1G29860	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AA54G00400

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018463617.1	3e-66	PREDICTED: probable WRKY transcription factor 71
Swissprot	Q93WV4	6e-63	WRK71_ARATH; WRKY transcription factor 71
TrEMBL	A0A3N6Q391	3e-63	A0A3N6Q391_BRACR; Uncharacterized protein
STRING	Bra032340.1-P	5e-63	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM13911	18	25

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G29860.1	2e-65	WRKY DNA-binding protein 71

Publications ? help Back to Top
Guo D, et al. The WRKY Transcription Factor WRKY71/EXB1 Controls Shoot Branching by Transcriptionally Regulating RAX Genes in Arabidopsis. Plant Cell, 2015. 27(11): p. 3112-27 [PMID:26578700] Yu Y, et al. WRKY71 accelerates flowering via the direct activation of FLOWERING LOCUS T and LEAFY in Arabidopsis thaliana. Plant J., 2016. 85(1): p. 96-106 [PMID:26643131] Guo D,Qin G EXB1/WRKY71 transcription factor regulates both shoot branching and responses to abiotic stresses. Plant Signal Behav, 2016. 11(3): p. e1150404 [PMID:26914912] Yu Y, et al. WRKY71 Acts Antagonistically Against Salt-Delayed Flowering in Arabidopsis thaliana. Plant Cell Physiol., 2018. 59(2): p. 414-422 [PMID:29272465]