![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AA60G00072 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 169aa MW: 18519.7 Da PI: 8.4647 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 175.5 | 5.3e-55 | 32 | 126 | 1 | 95 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
vreqdrflPian+srimk+ lP n+ki+kdak+tvqecvsefisfvtseasdkcqrekrktingddllwa+atlGfe y+eplk+yl++yre ++
AA60G00072 32 VREQDRFLPIANISRIMKRGLPPNGKIAKDAKDTVQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFESYIEPLKIYLMRYREGDT 126
69*****************************************************************************************9665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.1E-52 | 28 | 148 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 8.23E-39 | 35 | 138 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.4E-27 | 38 | 102 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.6E-21 | 66 | 84 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 69 | 85 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 2.6E-21 | 85 | 103 | No hit | No description |
| PRINTS | PR00615 | 2.6E-21 | 104 | 122 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 169 aa Download sequence Send to blast |
MAESQNKSSG MSPGACGSHE SGGDQSPKSS QVREQDRFLP IANISRIMKR GLPPNGKIAK 60 DAKDTVQECV SEFISFVTSE ASDKCQREKR KTINGDDLLW AMATLGFESY IEPLKIYLMR 120 YREGDTKGSA KGGDMNAKKD VQSSQNGQFS QLAHQGSFSQ DPYGNSQIK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_B | 3e-47 | 33 | 123 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 3e-47 | 33 | 123 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AA60G00072 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK353083 | 1e-135 | AK353083.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-13-K14. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006410886.1 | 1e-103 | nuclear transcription factor Y subunit B-8 | ||||
| Swissprot | Q8VYK4 | 2e-99 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | E4MX36 | 1e-102 | E4MX36_EUTHA; mRNA, clone: RTFL01-13-K14 | ||||
| TrEMBL | V4M7P8 | 1e-102 | V4M7P8_EUTSA; Uncharacterized protein | ||||
| STRING | Bostr.23794s0383.1.p | 1e-105 | (Boechera stricta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM1480 | 27 | 94 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G37060.3 | 1e-102 | nuclear factor Y, subunit B8 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




