| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | bZIP_1 | 38.3 | 2.8e-12 | 161 | 207 | 4 | 50 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50
+k+ rr+ +NR AA rsR+RKk++++ Le+k+k Le e ++L l+
AA71G00021 161 DKKRRRRLRNRDAAVRSRERKKEYVKDLETKSKYLERECMRLGRMLQ 207
79*************************************99976665 PP
|
| Publications
? help Back to Top |
- Deng Y,Srivastava R,Howell SH
Protein kinase and ribonuclease domains of IRE1 confer stress tolerance, vegetative growth, and reproductive development in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(48): p. 19633-8 [PMID:24145452] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Nagashima Y,Iwata Y,Ashida M,Mishiba K,Koizumi N
Exogenous salicylic acid activates two signaling arms of the unfolded protein response in Arabidopsis. Plant Cell Physiol., 2014. 55(10): p. 1772-8 [PMID:25138441] - Parra-Rojas J,Moreno AA,Mitina I,Orellana A
The dynamic of the splicing of bZIP60 and the proteins encoded by the spliced and unspliced mRNAs reveals some unique features during the activation of UPR in Arabidopsis thaliana. PLoS ONE, 2015. 10(4): p. e0122936 [PMID:25860807] - Zhang L,Chen H,Brandizzi F,Verchot J,Wang A
The UPR branch IRE1-bZIP60 in plants plays an essential role in viral infection and is complementary to the only UPR pathway in yeast. PLoS Genet., 2015. 11(4): p. e1005164 [PMID:25875739] - Walley J, et al.
Plastid-produced interorgannellar stress signal MEcPP potentiates induction of the unfolded protein response in endoplasmic reticulum. Proc. Natl. Acad. Sci. U.S.A., 2015. 112(19): p. 6212-7 [PMID:25922532] - Ma ZX, et al.
The THERMOSENSITIVE MALE STERILE 1 Interacts with the BiPs via DnaJ Domain and Stimulates Their ATPase Enzyme Activities in Arabidopsis. PLoS ONE, 2015. 10(7): p. e0132500 [PMID:26186593] - Sagor GH, et al.
The polyamine spermine induces the unfolded protein response via the MAPK cascade in Arabidopsis. Front Plant Sci, 2015. 6: p. 687 [PMID:26442007] - Deng Y, et al.
IRE1, a component of the unfolded protein response signaling pathway, protects pollen development in Arabidopsis from heat stress. Plant J., 2016. 88(2): p. 193-204 [PMID:27304577] - Gaguancela OA, et al.
The IRE1/bZIP60 Pathway and Bax Inhibitor 1 Suppress Systemic Accumulation of Potyviruses and Potexviruses in Arabidopsis and Nicotiana benthamiana Plants. Mol. Plant Microbe Interact., 2016. 29(10): p. 750-766 [PMID:27578623] - Meng Z,Ruberti C,Gong Z,Brandizzi F
CPR5 modulates salicylic acid and the unfolded protein response to manage tradeoffs between plant growth and stress responses. Plant J., 2017. 89(3): p. 486-501 [PMID:27747970] - Wang B,Du H,Zhang Z,Xu W,Deng X
BhbZIP60 from Resurrection Plant Boea hygrometrica Is an mRNA Splicing-Activated Endoplasmic Reticulum Stress Regulator Involved in Drought Tolerance. Front Plant Sci, 2017. 8: p. 245 [PMID:28286511] - Li Q, et al.
Unfolded protein response activation compensates endoplasmic reticulum-associated degradation deficiency in Arabidopsis. J Integr Plant Biol, 2017. 59(7): p. 506-521 [PMID:28418178] - Zhang SS, et al.
Tissue-Specific Transcriptomics Reveals an Important Role of the Unfolded Protein Response in Maintaining Fertility upon Heat Stress in Arabidopsis. Plant Cell, 2017. 29(5): p. 1007-1023 [PMID:28442596] - Ezer D, et al.
The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] - Ruberti C,Lai Y,Brandizzi F
Recovery from temporary endoplasmic reticulum stress in plants relies on the tissue-specific and largely independent roles of bZIP28 and bZIP60, as well as an antagonizing function of BAX-Inhibitor 1 upon the pro-adaptive signaling mediated by bZIP28. Plant J., 2018. 93(1): p. 155-165 [PMID:29124827] - Kim JS,Yamaguchi-Shinozaki K,Shinozaki K
ER-Anchored Transcription Factors bZIP17 and bZIP28 Regulate Root Elongation. Plant Physiol., 2018. 176(3): p. 2221-2230 [PMID:29367234]
|