![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AA79G00042 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 139aa MW: 16302.1 Da PI: 9.7914 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 83.8 | 1e-26 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+i++k++rqv+f+kRrng+lKKA+ELS+LCda++a+i+fs++ kly +ss
AA79G00042 9 KKIKEKIKRQVSFAKRRNGLLKKAHELSILCDAQIALILFSENHKLYHFSS 59
689**********************************************96 PP
| |||||||
| 2 | K-box | 20.8 | 1.6e-08 | 91 | 138 | 22 | 69 |
K-box 22 akLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69
+ Lk+eie+L+ ++ + G +L+ Ls+ ++ +Le qL++sl ++ ++K
AA79G00042 91 EALKREIETLKLNLELYGGHNLTILSFDQILRLELQLQSSLHNVQARK 138
579********************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 2.4E-33 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 29.002 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 2.49E-29 | 3 | 86 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.7E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 5.2E-23 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.7E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.7E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS51297 | 7.817 | 83 | 139 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0030308 | Biological Process | negative regulation of cell growth | ||||
| GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
| GO:0048530 | Biological Process | fruit morphogenesis | ||||
| GO:0080060 | Biological Process | integument development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 139 aa Download sequence Send to blast |
MRRGKIEIKK IKEKIKRQVS FAKRRNGLLK KAHELSILCD AQIALILFSE NHKLYHFSSD 60 STNIDDIILR YQMCMQQERG HECTNCVEIK EALKREIETL KLNLELYGGH NLTILSFDQI 120 LRLELQLQSS LHNVQARKV |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 5e-20 | 1 | 95 | 1 | 90 | MEF2 CHIMERA |
| 6byy_B | 5e-20 | 1 | 95 | 1 | 90 | MEF2 CHIMERA |
| 6byy_C | 5e-20 | 1 | 95 | 1 | 90 | MEF2 CHIMERA |
| 6byy_D | 5e-20 | 1 | 95 | 1 | 90 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 1 | 17 | RRGKIEIKKIKEKIKRQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the regulation of fruit growth. Contributes to integument development. Controls organ size via cell expansion (PubMed:20088901). Involved in the regulation of longitudinal growth of the fruit evenly throughout the radial axis (PubMed:20598091). Functions redundantly with TT16/AGL32 to repress nucellus growth and promote its degeneration (PubMed:27233529). {ECO:0000269|PubMed:20088901, ECO:0000269|PubMed:20598091, ECO:0000269|PubMed:27233529}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00172 | DAP | Transfer from AT1G31140 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AA79G00042 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006306362.2 | 4e-48 | agamous-like MADS-box protein AGL63 | ||||
| Swissprot | Q9SA07 | 2e-46 | AGL63_ARATH; Agamous-like MADS-box protein AGL63 | ||||
| TrEMBL | A0A2H4FR43 | 9e-47 | A0A2H4FR43_9BRAS; MADS-box transcription factor AGL63 | ||||
| STRING | Cagra.1508s0081.1.p | 5e-46 | (Capsella grandiflora) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM78 | 28 | 413 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G31140.1 | 6e-43 | GORDITA | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




