PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AHYPO_003558-RA

Organism

Amaranthus hypochondriacus

Taxonomic ID

28502

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus

Family

M-type_MADS

Protein Properties

Length: 62aa MW: 6951.17 Da PI: 11.148

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AHYPO_003558-RA	genome	BYU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	93	1.4e-29	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr g+lKKA+E+SvLCda+ aviifs++gkl+ y++ AHYPO_003558-RA 9 KRIENKINRQVTFSKRRIGLLKKAHEISVLCDADTAVIIFSTKGKLFQYAT 59 79***********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.5E-36	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	30.796	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.31E-33	2	61	No hit	No description
SuperFamily	SSF55455	3.14E-27	2	61	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.6E-30	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	4.8E-25	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.6E-30	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.6E-30	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 62 aa Download sequence Send to blast
MGRGRVQLKR IENKINRQVT FSKRRIGLLK KAHEISVLCD ADTAVIIFST KGKLFQYATD 60 S*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	3e-21	1	59	1	59	MEF2C
5f28_B	3e-21	1	59	1	59	MEF2C
5f28_C	3e-21	1	59	1	59	MEF2C
5f28_D	3e-21	1	59	1	59	MEF2C
6bz1_A	3e-21	1	59	1	59	MEF2 CHIMERA
6bz1_B	3e-21	1	59	1	59	MEF2 CHIMERA
6bz1_C	3e-21	1	59	1	59	MEF2 CHIMERA
6bz1_D	3e-21	1	59	1	59	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.
UniProt	Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1 and CAULIFLOWER. Is required subsequently for the transition of an inflorescence meristem into a floral meristem (PubMed:28586421). Seems to be partially redundant to the function of APETALA1 and CAULIFLOWER in the up-regulation of LEAFY. Is also required for normal pattern of cell division, expansion and differentiation during morphogenesis of the silique (PubMed:28586421). Probably not required for fruit elongation but instead is required to prevent ectopic activity of IND. Represses SAUR10 expression in stems and inflorescence branches (PubMed:28586421). {ECO:0000269\|PubMed:10648231, ECO:0000269\|PubMed:15035986, ECO:0000269\|PubMed:28586421, ECO:0000269\|PubMed:9502732}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Dramatically up-regulated upon the transition from vegetative to reproductive development.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009761886.1	5e-34	PREDICTED: agamous-like MADS-box protein AGL8 homolog
Refseq	XP_016468661.1	5e-34	PREDICTED: agamous-like MADS-box protein AGL8 homolog
Refseq	XP_021855267.1	1e-33	truncated transcription factor CAULIFLOWER A-like
Swissprot	Q38876	7e-33	AGL8_ARATH; Agamous-like MADS-box protein AGL8
Swissprot	Q41274	6e-33	AGL8_SINAL; Agamous-like MADS-box protein AGL8 homolog
TrEMBL	A0A1S3ZW89	1e-32	A0A1S3ZW89_TOBAC; agamous-like MADS-box protein AGL8 homolog
TrEMBL	A0A1U7VA77	1e-32	A0A1U7VA77_NICSY; agamous-like MADS-box protein AGL8 homolog
TrEMBL	A0A438E383	1e-32	A0A438E383_VITVI; Agamous-like MADS-box protein AGL8
STRING	POPTR_0004s11430.1	2e-33	(Populus trichocarpa)
STRING	cassava4.1_028214m	2e-33	(Manihot esculenta)
STRING	XP_009761886.1	2e-33	(Nicotiana sylvestris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60910.1	3e-35	AGAMOUS-like 8

Link Out ? help Back to Top
Phytozome	AHYPO_003558-RA

Publications ? help Back to Top
Yu Y, et al. MlWRKY12, a novel Miscanthus transcription factor, participates in pith secondary cell wall formation and promotes flowering. Plant Sci., 2013. 212: p. 1-9 [PMID:24094048] Pabón-Mora N,Wong GK,Ambrose BA Evolution of fruit development genes in flowering plants. Front Plant Sci, 2014. 5: p. 300 [PMID:25018763] Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons. GM Crops Food, 2014. 5(4): p. 302-20 [PMID:25523176] Wang C,Dehesh K From retrograde signaling to flowering time. Plant Signal Behav, 2015. 10(6): p. e1022012 [PMID:26098376] Borghi M,Xie DY Tissue-specific production of limonene in Camelina sativa with the Arabidopsis promoters of genes BANYULS and FRUITFULL. Planta, 2016. 243(2): p. 549-61 [PMID:26530959] Yu Y, et al. WRKY71 accelerates flowering via the direct activation of FLOWERING LOCUS T and LEAFY in Arabidopsis thaliana. Plant J., 2016. 85(1): p. 96-106 [PMID:26643131] McCarthy EW,Mohamed A,Litt A Functional Divergence of APETALA1 and FRUITFULL is due to Changes in both Regulation and Coding Sequence. Front Plant Sci, 2015. 6: p. 1076 [PMID:26697035] Davin N, et al. Functional network analysis of genes differentially expressed during xylogenesis in soc1ful woody Arabidopsis plants. Plant J., 2016. 86(5): p. 376-90 [PMID:26952251] Hyun Y, et al. Multi-layered Regulation of SPL15 and Cooperation with SOC1 Integrate Endogenous Flowering Pathways at the Arabidopsis Shoot Meristem. Dev. Cell, 2016. 37(3): p. 254-66 [PMID:27134142] José Ripoll J, et al. microRNA regulation of fruit growth. Nat Plants, 2015. 1(4): p. 15036 [PMID:27247036] Li W,Wang H,Yu D Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions. Mol Plant, 2016. 9(11): p. 1492-1503 [PMID:27592586] Eldridge T, et al. Fruit shape diversity in the Brassicaceae is generated by varying patterns of anisotropy. Development, 2016. 143(18): p. 3394-406 [PMID:27624834] Bemer M, et al. FRUITFULL controls SAUR10 expression and regulates Arabidopsis growth and architecture. J. Exp. Bot., 2017. 68(13): p. 3391-3403 [PMID:28586421] Sehra B,Franks RG Redundant CArG Box Cis-motif Activity Mediates SHATTERPROOF2 Transcriptional Regulation during Arabidopsis thaliana Gynoecium Development. Front Plant Sci, 2017. 8: p. 1712 [PMID:29085379] Balanzà V, et al. Genetic control of meristem arrest and life span in Arabidopsis by a FRUITFULL-APETALA2 pathway. Nat Commun, 2018. 9(1): p. 565 [PMID:29422669] Menzel G,Apel K,Melzer S Identification of two MADS box genes that are expressed in the apical meristem of the long-day plant Sinapis alba in transition to flowering. Plant J., 1996. 9(3): p. 399-408 [PMID:8919916]