![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AHYPO_004119-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 116aa MW: 13279.7 Da PI: 7.8574 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 134 | 4.8e-42 | 28 | 103 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
Cq+++C+adl+eak+yhrrhkvCe+h+kapvv+v+ ++qrfCqqCs+fhelsefD++krsCr+rLa+hnerrrk++
AHYPO_004119-RA 28 CQADDCTADLTEAKRYHRRHKVCEFHAKAPVVIVNTIHQRFCQQCSKFHELSEFDDTKRSCRSRLAGHNERRRKNS 103
**************************************************************************87 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.1100.10 | 1.7E-33 | 23 | 89 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 30.898 | 25 | 102 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 3.73E-38 | 26 | 104 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 1.6E-32 | 28 | 101 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009911 | Biological Process | positive regulation of flower development | ||||
| GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
| GO:0010229 | Biological Process | inflorescence development | ||||
| GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 116 aa Download sequence Send to blast |
IKMEGYHENE YEEVIRGGSS LAASIVYCQA DDCTADLTEA KRYHRRHKVC EFHAKAPVVI 60 VNTIHQRFCQ QCSKFHELSE FDDTKRSCRS RLAGHNERRR KNSSRDVSED NSSSS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 4e-37 | 18 | 101 | 1 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00634 | PBM | Transfer from PK22320.1 | Download |
| |||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021726481.1 | 1e-54 | squamosa promoter-binding protein 1-like isoform X2 | ||||
| Swissprot | Q38741 | 2e-38 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
| TrEMBL | A0A0K9QKM8 | 2e-51 | A0A0K9QKM8_SPIOL; Uncharacterized protein | ||||
| STRING | cassava4.1_018710m | 3e-45 | (Manihot esculenta) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G33810.1 | 2e-39 | squamosa promoter binding protein-like 3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AHYPO_004119-RA |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




