![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AHYPO_004169-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 65aa MW: 7311.21 Da PI: 4.9091 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 63.4 | 7.1e-20 | 15 | 61 | 1 | 48 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
lppGfrFhPtdeel+v+yLk+k+++++l++ ++i+evd+yk++Pw+Lp
AHYPO_004169-RA 15 LPPGFRFHPTDEELIVHYLKRKASSSPLPV-SIIAEVDLYKFDPWELP 61
79****************************.89**************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 3.79E-22 | 7 | 63 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 23.161 | 15 | 64 | IPR003441 | NAC domain |
| Pfam | PF02365 | 3.9E-9 | 16 | 57 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 65 aa Download sequence Send to blast |
MESTDSSNTQ PYPQLPPGFR FHPTDEELIV HYLKRKASSS PLPVSIIAEV DLYKFDPWEL 60 PSHA* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 7e-22 | 14 | 64 | 14 | 64 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor of the NAC family. May be associated with anther development and pollen production (Probable). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305|PubMed:21107887}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010686575.1 | 2e-36 | PREDICTED: NAC transcription factor 25 | ||||
| Swissprot | Q8GY42 | 2e-27 | NAC25_ARATH; NAC transcription factor 25 | ||||
| TrEMBL | A0A0K9QEW3 | 3e-34 | A0A0K9QEW3_SPIOL; Uncharacterized protein | ||||
| STRING | XP_010686575.1 | 8e-36 | (Beta vulgaris) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G61110.1 | 9e-30 | NAC domain containing protein 25 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AHYPO_004169-RA |




