PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AHYPO_005128-RA

Organism

Amaranthus hypochondriacus

Taxonomic ID

28502

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus

Family

M-type_MADS

Protein Properties

Length: 78aa MW: 8939.35 Da PI: 10.6551

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AHYPO_005128-RA	genome	BYU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	89.5	1.8e-28	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +ri+n++ rqvtfskRr g+lKKA ELS+LCdaev v+ifsst klye++s AHYPO_005128-RA 9 ERIDNSTSRQVTFSKRRSGLLKKARELSILCDAEVGVVIFSSTRKLYEFAS 59 69***********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	30.936	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	8.5E-38	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.96E-32	2	74	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.28E-40	2	71	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.5E-28	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	5.0E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.5E-28	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.5E-28	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 78 aa Download sequence Send to blast
MGRGKIVIER IDNSTSRQVT FSKRRSGLLK KARELSILCD AEVGVVIFSS TRKLYEFAST 60 NMKSVIERYN KMKEENGH

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	1e-23	1	76	1	76	MEF2C
5f28_B	1e-23	1	76	1	76	MEF2C
5f28_C	1e-23	1	76	1	76	MEF2C
5f28_D	1e-23	1	76	1	76	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional factor that targets the CArG motif 5'-C(A/T)TTAAAAAG-3' in the promoter of D14. Directly suppresses D14 expression to control the outgrowth of axillary buds. {ECO:0000269\|PubMed:23463009}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021717229.1	4e-44	MADS-box transcription factor 23-like isoform X2
Refseq	XP_021717230.1	9e-45	MADS-box transcription factor ANR1-like isoform X3
Swissprot	Q6Z6W2	1e-38	MAD57_ORYSJ; MADS-box transcription factor 57
TrEMBL	A0A4D8Y3K7	1e-40	A0A4D8Y3K7_SALSN; MADS-box transcription factor, plant
STRING	XP_010691452.1	3e-40	(Beta vulgaris)
STRING	XP_002518331.1	8e-40	(Ricinus communis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G14210.1	2e-40	AGAMOUS-like 44

Link Out ? help Back to Top
Phytozome	AHYPO_005128-RA

Publications ? help Back to Top
Guo S, et al. The interaction between OsMADS57 and OsTB1 modulates rice tillering via DWARF14. Nat Commun, 2013. 4: p. 1566 [PMID:23463009] Puig J, et al. Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice. Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70 [PMID:23466806] Yu C, et al. The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice. PLoS ONE, 2014. 9(8): p. e105597 [PMID:25140876] Wang H, et al. A Signaling Cascade from miR444 to RDR1 in Rice Antiviral RNA Silencing Pathway. Plant Physiol., 2016. 170(4): p. 2365-77 [PMID:26858364]