PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AHYPO_006852-RA

Organism

Amaranthus hypochondriacus

Taxonomic ID

28502

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus

Family

NF-YB

Protein Properties

Length: 51aa MW: 5585.5 Da PI: 9.9466

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AHYPO_006852-RA	genome	BYU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	88.3	8e-28	1	49	17	65
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingd 65 mkk+lPanakiskdaketvqec+s+fisf+t+easdkcqrekrkting+ AHYPO_006852-RA 1 MKKALPANAKISKDAKETVQECISKFISFITGEASDKCQREKRKTINGE 49 9**********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF00808	7.7E-18	1	49	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
Gene3D	G3DSA:1.10.20.10	3.6E-24	1	49	IPR009072	Histone-fold
SuperFamily	SSF47113	1.34E-17	1	49	IPR009072	Histone-fold
PRINTS	PR00615	6.0E-9	19	37	No hit	No description
PRINTS	PR00615	6.0E-9	38	50	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 51 aa Download sequence Send to blast
MKKALPANAK ISKDAKETVQ ECISKFISFI TGEASDKCQR EKRKTINGEI *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	4e-21	1	49	17	65	Transcription factor HapC (Eurofung)
4g92_B	4e-21	1	49	17	65	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}.
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021294217.1	1e-26	nuclear transcription factor Y subunit B-2 isoform X1
Swissprot	O23310	3e-27	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
Swissprot	Q75IZ7	1e-26	NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8
TrEMBL	A0A1S3YX01	5e-25	A0A1S3YX01_TOBAC; nuclear transcription factor Y subunit B-3
TrEMBL	A0A2U1QH69	5e-25	A0A2U1QH69_ARTAN; NF-Y protein
STRING	ORUFI03G21970.1	1e-25	(Oryza rufipogon)
STRING	Traes_2AS_B3BC47BB0.1	3e-26	(Triticum aestivum)
STRING	Traes_3DS_833AD0EE2.1	5e-26	(Triticum aestivum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	1e-29	nuclear factor Y, subunit B3

Link Out ? help Back to Top
Phytozome	AHYPO_006852-RA

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Kim SK, et al. OsNF-YC2 and OsNF-YC4 proteins inhibit flowering under long-day conditions in rice. Planta, 2016. 243(3): p. 563-76 [PMID:26542958] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]