 |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AHYPO_007058-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 177aa MW: 20072.3 Da PI: 8.6355 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 100.1 | 8.6e-32 | 27 | 76 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+
AHYPO_007058-RA 27 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 76
79***********************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 33.571 | 19 | 79 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 3.3E-41 | 19 | 78 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 6.28E-44 | 20 | 96 | No hit | No description |
| SuperFamily | SSF55455 | 2.49E-32 | 20 | 93 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 21 | 75 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.1E-33 | 21 | 41 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 5.1E-27 | 28 | 75 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.1E-33 | 41 | 56 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.1E-33 | 56 | 77 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 177 aa Download sequence Send to blast |
MEFNTQAMEI GSPSSQRKLG RGKIEIKRIE NTTNRQVTFC KRRNGLLKKA YELSVLCDAE 60 VALIVFSSRG RLYEYANHSH SVKGTINRYK KAYSDQSGAG SVAEANAQEI ELHNSNQFLQ 120 ARISENERAE QSMSLMPGAN EYEFVSNQSY DSQNYFQALQ PNTHYQRQDH TPLQLV* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 1e-20 | 19 | 77 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 1e-20 | 19 | 77 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 1e-20 | 19 | 77 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 1e-20 | 19 | 77 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 1e-20 | 19 | 77 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 1e-20 | 19 | 77 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 1e-20 | 19 | 77 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 1e-20 | 19 | 77 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 1e-20 | 19 | 77 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 1e-20 | 19 | 77 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021764203.1 | 7e-66 | floral homeotic protein AGAMOUS-like isoform X1 | ||||
| Refseq | XP_021764204.1 | 7e-66 | floral homeotic protein AGAMOUS-like isoform X1 | ||||
| Refseq | XP_021764205.1 | 7e-66 | floral homeotic protein AGAMOUS-like isoform X1 | ||||
| Refseq | XP_021764206.1 | 7e-66 | floral homeotic protein AGAMOUS-like isoform X1 | ||||
| Refseq | XP_021764208.1 | 6e-66 | floral homeotic protein AGAMOUS-like isoform X3 | ||||
| Refseq | XP_023894825.1 | 5e-66 | floral homeotic protein AGAMOUS isoform X4 | ||||
| Swissprot | Q40885 | 3e-52 | AG_PETHY; Floral homeotic protein AGAMOUS | ||||
| TrEMBL | A0A0P0HVT9 | 2e-70 | A0A0P0HVT9_MERAN; Agamous 2-like protein | ||||
| STRING | XP_010687169.1 | 3e-64 | (Beta vulgaris) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G18960.1 | 2e-52 | MIKC_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AHYPO_007058-RA |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||
| ©2010-2022, Center
for Bioinformatics, Peking University Last Modified: 2022-12-08 Questions or Comments, please contact  |
Supported By
|