PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_007401-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family NF-YB
Protein Properties Length: 51aa    MW: 5602.44 Da    PI: 8.7858
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_007401-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB91.58.4e-291491765
            NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingd 65
                     mkk+lP+nakiskdaketvqecvsefisf+t+easdkcqrekrkting+
  AHYPO_007401-RA  1 MKKALPTNAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGE 49
                     9**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008085.8E-19149IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.101.1E-25149IPR009072Histone-fold
SuperFamilySSF471131.17E-18149IPR009072Histone-fold
PRINTSPR006151.1E-91937No hitNo description
PROSITE patternPS0068502238IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.1E-93850No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 51 aa     Download sequence    Send to blast
MKKALPTNAK ISKDAKETVQ ECVSEFISFI TGEASDKCQR EKRKTINGEI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B4e-221491765Transcription factor HapC (Eurofung)
4g92_B4e-221491765Transcription factor HapC (Eurofung)
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. {ECO:0000250}.
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021294217.19e-27nuclear transcription factor Y subunit B-2 isoform X1
SwissprotO233102e-27NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
SwissprotQ75IZ76e-27NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8
TrEMBLA9SIX49e-26A9SIX4_PHYPA; Predicted protein (Fragment)
TrEMBLA9U3B51e-25A9U3B5_PHYPA; Predicted protein (Fragment)
STRINGORUFI03G21970.16e-26(Oryza rufipogon)
STRINGTraes_2AS_B3BC47BB0.12e-26(Triticum aestivum)
STRINGTraes_3DS_833AD0EE2.13e-26(Triticum aestivum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.18e-30nuclear factor Y, subunit B3
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Han X, et al.
    Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis.
    J. Exp. Bot., 2013. 64(14): p. 4589-601
    [PMID:24006421]
  3. Kim SK, et al.
    OsNF-YC2 and OsNF-YC4 proteins inhibit flowering under long-day conditions in rice.
    Planta, 2016. 243(3): p. 563-76
    [PMID:26542958]
  4. Hwang YH, et al.
    Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time.
    Plant Cell Rep., 2016. 35(4): p. 857-65
    [PMID:26754793]
  5. Hossain MA, et al.
    Identification of Novel Components of the Unfolded Protein Response in Arabidopsis.
    Front Plant Sci, 2016. 7: p. 650
    [PMID:27242851]
  6. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]