![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AHYPO_007401-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 51aa MW: 5602.44 Da PI: 8.7858 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 91.5 | 8.4e-29 | 1 | 49 | 17 | 65 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingd 65
mkk+lP+nakiskdaketvqecvsefisf+t+easdkcqrekrkting+
AHYPO_007401-RA 1 MKKALPTNAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGE 49
9**********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF00808 | 5.8E-19 | 1 | 49 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene3D | G3DSA:1.10.20.10 | 1.1E-25 | 1 | 49 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.17E-18 | 1 | 49 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 1.1E-9 | 19 | 37 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 22 | 38 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.1E-9 | 38 | 50 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 51 aa Download sequence Send to blast |
MKKALPTNAK ISKDAKETVQ ECVSEFISFI TGEASDKCQR EKRKTINGEI * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 4e-22 | 1 | 49 | 17 | 65 | Transcription factor HapC (Eurofung) |
| 4g92_B | 4e-22 | 1 | 49 | 17 | 65 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021294217.1 | 9e-27 | nuclear transcription factor Y subunit B-2 isoform X1 | ||||
| Swissprot | O23310 | 2e-27 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
| Swissprot | Q75IZ7 | 6e-27 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A9SIX4 | 9e-26 | A9SIX4_PHYPA; Predicted protein (Fragment) | ||||
| TrEMBL | A9U3B5 | 1e-25 | A9U3B5_PHYPA; Predicted protein (Fragment) | ||||
| STRING | ORUFI03G21970.1 | 6e-26 | (Oryza rufipogon) | ||||
| STRING | Traes_2AS_B3BC47BB0.1 | 2e-26 | (Triticum aestivum) | ||||
| STRING | Traes_3DS_833AD0EE2.1 | 3e-26 | (Triticum aestivum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 8e-30 | nuclear factor Y, subunit B3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AHYPO_007401-RA |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




