PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AHYPO_009962-RA

Organism

Amaranthus hypochondriacus

Taxonomic ID

28502

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus

Family

MYB

Protein Properties

Length: 207aa MW: 23856.5 Da PI: 7.9563

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AHYPO_009962-RA	genome	BYU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.2	1.7e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +lv +++q+G+ +W++++ g+ R+ k+c++rw +yl AHYPO_009962-RA 14 KGPWTPEEDIILVSYIQQHGPANWRSVPTNTGLQRCSKSCRLRWTNYL 61 79********************************************97 PP
2	Myb_DNA-binding	46.8	7e-15	67	112	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+ E+ ++++ ++lG++ W++Ia++++ Rt++++k++w+++l AHYPO_009962-RA 67 RGNFTPHEEGMIIHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 112 89******************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.1E-24	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.788	9	65	IPR017930	Myb domain
SuperFamily	SSF46689	1.99E-30	11	108	IPR009057	Homeodomain-like
SMART	SM00717	8.4E-13	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.2E-15	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	4.52E-10	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	3.3E-25	65	117	IPR009057	Homeodomain-like
SMART	SM00717	3.5E-13	66	114	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	18.75	66	116	IPR017930	Myb domain
Pfam	PF00249	2.7E-13	67	112	IPR001005	SANT/Myb domain
CDD	cd00167	6.85E-9	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 207 aa Download sequence Send to blast
MGRPPCCDKD GIKKGPWTPE EDIILVSYIQ QHGPANWRSV PTNTGLQRCS KSCRLRWTNY 60 LRPGIKRGNF TPHEEGMIIH LQALLGNKWA AIASYLPQRT DNDIKNYWNT HLKKKLKRAN 120 LDDNNNNNND NDNNNNNNNN NNNNNNYGSY TETILSFRNL VNNKIADTIT KEDEEENNPP 180 LTFLEKWLLD ESTMSRDEVL RLPTIF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	7e-25	14	116	27	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light) (PubMed:16005291, PubMed:21637967). Promotes guard cell deflation in response to water deficit. Triggers root growth upon osmotic stress (e.g. mannitol containing medium) (PubMed:21637967). {ECO:0000269\|PubMed:16005291, ECO:0000269\|PubMed:21637967}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by jasmonic acid (JA) and salicylic acid (SA) (PubMed:16463103). Triggered by auxin (IAA) in roots (PubMed:9839469, PubMed:21637967). Stimulated by light, UV-light and cold (PubMed:9839469). According to PubMed:16005291 and PubMed:23828545, rapidly repressed by abscisic acid (ABA) in an ABI1-dependent manner. But in contrast, according to PubMed:21637967, transiently induced by ABA in seedlings (PubMed:16005291, PubMed:21637967, PubMed:23828545). Rapidly repressed by drought. Activated by white light, but repressed by blue light and darkness (PubMed:16005291). Transiently induced by salt (NaCl) in seedlings. Induced by sucrose (PubMed:21637967). Positively regulated by SCAP1 (PubMed:23453954). {ECO:0000269\|PubMed:16005291, ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:21637967, ECO:0000269\|PubMed:23453954, ECO:0000269\|PubMed:23828545, ECO:0000269\|PubMed:9839469}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU094532	1e-149	EU094532.1 Amaranthus hypochondriacus clone AHAAT031 microsatellite sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020276146.1	5e-87	transcription factor MYB30-like isoform X1
Refseq	XP_020276147.1	5e-87	transcription factor MYB30-like isoform X1
Refseq	XP_020276148.1	5e-87	transcription factor MYB30-like isoform X1
Refseq	XP_020276149.1	5e-87	transcription factor MYB30-like isoform X1
Refseq	XP_020276150.1	4e-87	transcription factor MYB30-like isoform X2
Swissprot	Q8GYP5	3e-86	MYB60_ARATH; Transcription factor MYB60
TrEMBL	A0A068UWH9	9e-89	A0A068UWH9_COFCA; Uncharacterized protein
STRING	AT1G08810.1	1e-84	(Arabidopsis thaliana)
STRING	Bostr.25219s0065.1.p	1e-84	(Boechera stricta)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G08810.1	5e-84	myb domain protein 60

Link Out ? help Back to Top
Phytozome	AHYPO_009962-RA

Publications ? help Back to Top
Galbiati M, et al. Gene trap lines identify Arabidopsis genes expressed in stomatal guard cells. Plant J., 2008. 53(5): p. 750-62 [PMID:18036199] Rusconi F, et al. The Arabidopsis thaliana MYB60 promoter provides a tool for the spatio-temporal control of gene expression in stomatal guard cells. J. Exp. Bot., 2013. 64(11): p. 3361-71 [PMID:23828545] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Kim D,Ntui VO,Xiong L Arabidopsis YAK1 regulates abscisic acid response and drought resistance. FEBS Lett., 2016. 590(14): p. 2201-9 [PMID:27264339]