PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AHYPO_010073-RA

Organism

Amaranthus hypochondriacus

Taxonomic ID

28502

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus

Family

MYB_related

Protein Properties

Length: 109aa MW: 12928.3 Da PI: 10.8028

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AHYPO_010073-RA	genome	BYU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	43	1.1e-13	30	75	3	48
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 W+ Ede+l+ +v ++G + W+ + ++ g+ R++k+c++rw+++l AHYPO_010073-RA 30 IWSSAEDEKLKAYVLEFGAKKWEDVKKRTGLLRSGKSCRLRWLNHL 75 5***************************99**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	15.679	23	79	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	3.6E-17	26	78	IPR009057	Homeodomain-like
SMART	SM00717	5.0E-8	27	77	IPR001005	SANT/Myb domain
CDD	cd00167	2.87E-7	31	75	No hit	No description
SuperFamily	SSF46689	1.31E-20	31	106	IPR009057	Homeodomain-like
Pfam	PF13921	1.7E-12	31	89	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.4E-9	79	107	IPR009057	Homeodomain-like
PROSITE profile	PS51294	7.571	80	109	IPR017930	Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 109 aa Download sequence Send to blast
MDMISHTKKR RLQNVKKNLQ VGYSLKNRTI WSSAEDEKLK AYVLEFGAKK WEDVKKRTGL 60 LRSGKSCRLR WLNHLCPKLK KGHFTREEKN CIIKLYYKSG NQWSLIACK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	2e-14	27	107	26	105	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator (PubMed:24278028). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter to promote their expression (By similarity). Together with MYB101 and MYB120, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000250\|UniProtKB:O80883, ECO:0000269\|PubMed:23791732, ECO:0000269\|PubMed:24278028}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009381364.1	3e-26	PREDICTED: transcription factor GAMYB-like isoform X3
Refseq	XP_018674659.1	3e-26	PREDICTED: transcription factor GAMYB-like isoform X1
Refseq	XP_018674660.1	3e-26	PREDICTED: transcription factor GAMYB-like isoform X1
Refseq	XP_018674661.1	3e-26	PREDICTED: transcription factor GAMYB-like isoform X2
Swissprot	Q9S773	6e-24	MYB97_ARATH; Transcription factor MYB97
STRING	EMT09579	2e-25	(Aegilops tauschii)
STRING	LPERR05G16930.1	2e-25	(Leersia perrieri)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G26930.1	3e-26	myb domain protein 97

Link Out ? help Back to Top
Phytozome	AHYPO_010073-RA

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Zheng Z, et al. Target RNA Secondary Structure Is a Major Determinant of miR159 Efficacy. Plant Physiol., 2017. 174(3): p. 1764-1778 [PMID:28515145]