![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AHYPO_011266-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 64aa MW: 7097.32 Da PI: 11.6213 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 90.9 | 6.4e-29 | 10 | 58 | 2 | 50 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
ri+n++ rqvtfskRrng+lKKA+EL +LCda+v viifsstgkly+++
AHYPO_011266-RA 10 RIDNTTSRQVTFSKRRNGLLKKAKELAILCDAQVGVIIFSSTGKLYDFA 58
8***********************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 6.6E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 31.02 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 3.01E-36 | 2 | 60 | No hit | No description |
| SuperFamily | SSF55455 | 3.53E-28 | 2 | 61 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.0E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.4E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.0E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.0E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 64 aa Download sequence Send to blast |
MGRGKIVIRR IDNTTSRQVT FSKRRNGLLK KAKELAILCD AQVGVIIFSS TGKLYDFANN 60 RLN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 5e-18 | 1 | 63 | 1 | 63 | MEF2C |
| 5f28_B | 5e-18 | 1 | 63 | 1 | 63 | MEF2C |
| 5f28_C | 5e-18 | 1 | 63 | 1 | 63 | MEF2C |
| 5f28_D | 5e-18 | 1 | 63 | 1 | 63 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Required for root plasticity in response to nitrate, NO(3)(-). Promotes lateral root growth in a NRT1.1-dependent manner. {ECO:0000269|PubMed:15667327, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by nitrate in root cell culture, (PubMed:9430595, PubMed:17148611). In roots, seems induced by nitrogen (N) deprivation (e.g. nitrate free medium) but rapidly repressed by N re-supply (e.g. nitrate, glutamine and ammonium) (PubMed:16021502). Slight repression in shoots during nitrogen (N) deprivation. {ECO:0000269|PubMed:16021502, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019056396.1 | 8e-34 | PREDICTED: agamous-like MADS-box protein AGL16 | ||||
| Swissprot | Q9SI38 | 3e-33 | ANR1_ARATH; MADS-box transcription factor ANR1 | ||||
| TrEMBL | A0A0L9UYB2 | 1e-33 | A0A0L9UYB2_PHAAN; Uncharacterized protein | ||||
| TrEMBL | A0A3Q7ERK5 | 1e-33 | A0A3Q7ERK5_SOLLC; Uncharacterized protein | ||||
| STRING | Aquca_010_00060.1 | 5e-34 | (Aquilegia coerulea) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G14210.1 | 1e-35 | AGAMOUS-like 44 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AHYPO_011266-RA |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




