![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AHYPO_012150-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 95aa MW: 10424.8 Da PI: 8.3923 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 98.5 | 5.2e-31 | 29 | 86 | 2 | 60 |
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
++vrY eC+kNhAa+lGg+a+DGC+Efm+s g+++t al CaACgCHRnFHR eve++
AHYPO_012150-RA 29 RNVRYMECQKNHAANLGGYALDGCREFMAS-GDDATNLALVCAACGCHRNFHRLEVETQ 86
689**************************9.888999****************999876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 3.0E-24 | 1 | 94 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 5.0E-28 | 30 | 83 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 1.4E-25 | 32 | 82 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 24.484 | 33 | 82 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 95 aa Download sequence Send to blast |
MRKRQVVIKR SIGNEIRNST ITNSGHIHRN VRYMECQKNH AANLGGYALD GCREFMASGD 60 DATNLALVCA ACGCHRNFHR LEVETQVATE CSSS* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022773733.1 | 3e-39 | mini zinc finger protein 2-like | ||||
| Swissprot | Q9LJW5 | 2e-31 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
| TrEMBL | B9RLZ3 | 9e-37 | B9RLZ3_RICCO; Transcription factor, putative | ||||
| STRING | XP_010693242.1 | 1e-37 | (Beta vulgaris) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G28917.1 | 7e-34 | mini zinc finger 2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AHYPO_012150-RA |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




