![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AHYPO_012724-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 101aa MW: 11967.4 Da PI: 9.1115 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 43.9 | 5.2e-14 | 1 | 54 | 10 | 63 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
+++NRe+ArrsR RK+ ++eL v L +eN++L+++l++ ++ +++ +e+
AHYPO_012724-RA 1 MISNRESARRSRMRKQRHLDELWSQVVWLRNENHQLIDKLNHASQSHQRVLQEN 54
689***************************************999999988886 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50217 | 8.657 | 1 | 57 | IPR004827 | Basic-leucine zipper domain |
| CDD | cd14702 | 3.27E-14 | 1 | 48 | No hit | No description |
| SuperFamily | SSF57959 | 7.74E-12 | 1 | 46 | No hit | No description |
| Pfam | PF00170 | 4.3E-11 | 1 | 54 | IPR004827 | Basic-leucine zipper domain |
| SMART | SM00338 | 3.6E-7 | 1 | 56 | IPR004827 | Basic-leucine zipper domain |
| Gene3D | G3DSA:1.20.5.170 | 1.8E-9 | 2 | 48 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 101 aa Download sequence Send to blast |
MISNRESARR SRMRKQRHLD ELWSQVVWLR NENHQLIDKL NHASQSHQRV LQENLQLKQQ 60 TSELRQIITD IQIGSPYSSL QHFQEVVNGT YLDQDHQLPN * |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 8 | 15 | RRSRMRKQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010694542.1 | 4e-48 | PREDICTED: basic leucine zipper 43 | ||||
| Swissprot | Q9FMC2 | 3e-31 | BZP43_ARATH; Basic leucine zipper 43 | ||||
| TrEMBL | A0A1R3G3L2 | 7e-42 | A0A1R3G3L2_COCAP; Uncharacterized protein | ||||
| STRING | XP_010694542.1 | 2e-47 | (Beta vulgaris) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G30530.1 | 3e-40 | basic leucine-zipper 42 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AHYPO_012724-RA |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




