![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AHYPO_014059-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 69aa MW: 7518.78 Da PI: 8.7825 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 40 | 1.1e-12 | 33 | 67 | 1 | 35 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhk 35
+CaaCk+lrr+Ca++C+++pyf ++p+kfa+vhk
AHYPO_014059-RA 33 PCAACKLLRRRCAEECPFSPYFSPHEPQKFAAVHK 67
7*********************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 13.187 | 32 | 69 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 1.2E-11 | 33 | 67 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 69 aa Download sequence Send to blast |
MVASNSCYNM MGVGPTPTPT PPPLGTPLNT ITPCAACKLL RRRCAEECPF SPYFSPHEPQ 60 KFAAVHKRT |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021716783.1 | 9e-31 | LOB domain-containing protein 15-like | ||||
| Swissprot | Q9AT61 | 4e-23 | LBD13_ARATH; LOB domain-containing protein 13 | ||||
| TrEMBL | A0A0K9RA50 | 1e-24 | A0A0K9RA50_SPIOL; Uncharacterized protein | ||||
| STRING | XP_010685965.1 | 3e-25 | (Beta vulgaris) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G30340.1 | 1e-19 | LOB domain-containing protein 13 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AHYPO_014059-RA |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




