![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AHYPO_014198-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 86aa MW: 9906.81 Da PI: 10.8078 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 85.9 | 2.3e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+ien s rqvtf+kRr+g++KKA+ELS+LCda++ +i+fss+g+lyeys+
AHYPO_014198-RA 9 KKIENISARQVTFAKRRKGLIKKAQELSTLCDAQIGLIVFSSSGRLYEYST 59
78***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF55455 | 4.84E-26 | 1 | 63 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 28.917 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 4.9E-35 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.4E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 3.7E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.4E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.4E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 86 aa Download sequence Send to blast |
MVRSRIQIKK IENISARQVT FAKRRKGLIK KAQELSTLCD AQIGLIVFSS SGRLYEYSTS 60 RFISLPFSLL NLFIYLFFIY SFCKL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3mu6_A | 1e-15 | 3 | 60 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 3mu6_B | 1e-15 | 3 | 60 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 3mu6_C | 1e-15 | 3 | 60 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 3mu6_D | 1e-15 | 3 | 60 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 6byy_A | 2e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6byy_B | 2e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6byy_C | 2e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| 6byy_D | 2e-15 | 1 | 60 | 1 | 60 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MADS-box transcription factor that acts with AGL42 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021773608.1 | 4e-30 | MADS-box protein AGL24-like | ||||
| Refseq | XP_021773613.1 | 4e-30 | MADS-box protein AGL24-like | ||||
| Swissprot | Q9LT93 | 5e-25 | AGL71_ARATH; MADS-box protein AGL71 | ||||
| TrEMBL | A0A0K9QJB0 | 1e-28 | A0A0K9QJB0_SPIOL; Uncharacterized protein | ||||
| TrEMBL | A0A0K9QV68 | 3e-28 | A0A0K9QV68_SPIOL; Uncharacterized protein | ||||
| TrEMBL | A0A0K9QWT3 | 3e-28 | A0A0K9QWT3_SPIOL; Uncharacterized protein | ||||
| STRING | XP_010690400.1 | 6e-28 | (Beta vulgaris) | ||||
| STRING | XP_010691402.1 | 7e-28 | (Beta vulgaris) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G51870.2 | 1e-27 | AGAMOUS-like 71 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AHYPO_014198-RA |




