![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AHYPO_014996-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
|
||||||||
| Family | TCP | ||||||||
| Protein Properties | Length: 91aa MW: 9790.9 Da PI: 10.6147 | ||||||||
| Description | TCP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | TCP | 79.2 | 1.1e-24 | 43 | 90 | 2 | 49 |
TCP 2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktie 49
ag kdrhsk++T++g+RdRR Rlsa++a++f+d+qd+LG+d++sk+++
AHYPO_014996-RA 43 AGLKDRHSKVCTAKGPRDRRARLSAHTAIQFYDVQDRLGYDRPSKAVD 90
788*******************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03634 | 3.2E-22 | 45 | 90 | IPR005333 | Transcription factor, TCP |
| PROSITE profile | PS51369 | 24.926 | 45 | 90 | IPR017887 | Transcription factor TCP subgroup |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 91 aa Download sequence Send to blast |
MGIGDSSSQQ HKQQQSGSNR ASLRKSGIGE IVEVQGGQIV QAAGLKDRHS KVCTAKGPRD 60 RRARLSAHTA IQFYDVQDRL GYDRPSKAVD * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5zkt_A | 1e-16 | 50 | 90 | 1 | 41 | Putative transcription factor PCF6 |
| 5zkt_B | 1e-16 | 50 | 90 | 1 | 41 | Putative transcription factor PCF6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor playing a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164) (PubMed:12931144, PubMed:17307931). Required during early steps of embryogenesis (PubMed:15634699). Participates in ovule develpment (PubMed:25378179). Activates LOX2 expression by binding to the 5'-GGACCA-3' motif found in its promoter (PubMed:18816164). {ECO:0000269|PubMed:12931144, ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:18816164, ECO:0000269|PubMed:25378179}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by the miRNA miR-JAW/miR319 (PubMed:12931144, PubMed:18816164). {ECO:0000269|PubMed:12931144, ECO:0000269|PubMed:18816164}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021851388.1 | 3e-39 | transcription factor TCP4-like | ||||
| Refseq | XP_021851389.1 | 3e-39 | transcription factor TCP4-like | ||||
| Refseq | XP_021851390.1 | 3e-39 | transcription factor TCP4-like | ||||
| Refseq | XP_021851391.1 | 3e-39 | transcription factor TCP4-like | ||||
| Swissprot | Q8LPR5 | 8e-34 | TCP4_ARATH; Transcription factor TCP4 | ||||
| TrEMBL | A0A0K9RU33 | 6e-38 | A0A0K9RU33_SPIOL; Uncharacterized protein | ||||
| STRING | Aquca_005_00099.1 | 1e-35 | (Aquilegia coerulea) | ||||
| STRING | XP_007133163.1 | 9e-36 | (Phaseolus vulgaris) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G31070.1 | 1e-34 | TCP domain protein 10 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AHYPO_014996-RA |




