PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AHYPO_017136-RA

Organism

Amaranthus hypochondriacus

Taxonomic ID

28502

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus

Family

M-type_MADS

Protein Properties

Length: 69aa MW: 7686.92 Da PI: 10.5916

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AHYPO_017136-RA	genome	BYU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	94.1	6.5e-30	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 kri+++snrqvtfskRrng+lKKA ELS+LCda+v v++fsstgkly+++s AHYPO_017136-RA 9 KRIDDSSNRQVTFSKRRNGLLKKARELSILCDADVGVVVFSSTGKLYDFAS 59 79***********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	31.497	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.6E-40	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	6.67E-29	2	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.67E-37	2	60	No hit	No description
PRINTS	PR00404	2.4E-29	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.1E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.4E-29	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.4E-29	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 69 aa Download sequence Send to blast
MGRGKIVIKR IDDSSNRQVT FSKRRNGLLK KARELSILCD ADVGVVVFSS TGKLYDFASS 60 KYVFYTLH*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	1e-20	1	60	1	60	MEF2C
5f28_B	1e-20	1	60	1	60	MEF2C
5f28_C	1e-20	1	60	1	60	MEF2C
5f28_D	1e-20	1	60	1	60	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.
UniProt	Transcriptional factor that targets the CArG motif 5'-C(A/T)TTAAAAAG-3' in the promoter of D14. Directly suppresses D14 expression to control the outgrowth of axillary buds. {ECO:0000269\|PubMed:23463009}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022768505.1	3e-31	agamous-like MADS-box protein AGL21
Refseq	XP_022768506.1	3e-31	agamous-like MADS-box protein AGL21
Refseq	XP_028783668.1	3e-31	agamous-like MADS-box protein AGL21
Refseq	XP_028785048.1	3e-31	agamous-like MADS-box protein AGL21
Swissprot	Q6Z6W2	2e-29	MAD57_ORYSJ; MADS-box transcription factor 57
Swissprot	Q9SZJ6	2e-29	AGL21_ARATH; Agamous-like MADS-box protein AGL21
TrEMBL	A0A0L9UYB2	3e-31	A0A0L9UYB2_PHAAN; Uncharacterized protein
TrEMBL	A0A251RHN1	2e-31	A0A251RHN1_PRUPE; Uncharacterized protein
TrEMBL	A0A427AGR1	3e-31	A0A427AGR1_ENSVE; Uncharacterized protein
STRING	Bo1g003270.1	6e-32	(Brassica oleracea)
STRING	Bo3g153080.1	5e-32	(Brassica oleracea)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G37940.1	7e-32	AGAMOUS-like 21

Link Out ? help Back to Top
Phytozome	AHYPO_017136-RA

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Guo S, et al. The interaction between OsMADS57 and OsTB1 modulates rice tillering via DWARF14. Nat Commun, 2013. 4: p. 1566 [PMID:23463009] Puig J, et al. Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice. Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70 [PMID:23466806] Yu C, et al. The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice. PLoS ONE, 2014. 9(8): p. e105597 [PMID:25140876] Wang H, et al. A Signaling Cascade from miR444 to RDR1 in Rice Antiviral RNA Silencing Pathway. Plant Physiol., 2016. 170(4): p. 2365-77 [PMID:26858364] Yu LH, et al. Arabidopsis MADS-Box Transcription Factor AGL21 Acts as Environmental Surveillance of Seed Germination by Regulating ABI5 Expression. Mol Plant, 2017. 10(6): p. 834-845 [PMID:28438576] Qu Y, et al. Peroxisomal CuAOζ and its product H2O2 regulate the distribution of auxin and IBA-dependent lateral root development in Arabidopsis. J. Exp. Bot., 2017. 68(17): p. 4851-4867 [PMID:28992128] Sun CH, et al. Chrysanthemum MADS-box transcription factor CmANR1 modulates lateral root development via homo-/heterodimerization to influence auxin accumulation in Arabidopsis. Plant Sci., 2018. 266: p. 27-36 [PMID:29241564]