![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AHYPO_018889-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 92aa MW: 10606.2 Da PI: 10.6255 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 59.3 | 8.4e-19 | 17 | 64 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g W++eEde+l ++++q+G g+W+tI+ g+ R +k+c++rw +yl
AHYPO_018889-RA 17 KGLWSPEEDERLRNYINQHGHGCWSTIPINAGLQRNGKSCRLRWINYL 64
678*******************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 24.255 | 12 | 68 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 5.4E-24 | 13 | 67 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.2E-12 | 16 | 66 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 5.6E-16 | 17 | 64 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 3.8E-22 | 19 | 91 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 6.55E-11 | 20 | 64 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.0E-8 | 68 | 91 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 7.407 | 69 | 91 | IPR017930 | Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 92 aa Download sequence Send to blast |
MGYKPLQESK PKIKHRKGLW SPEEDERLRN YINQHGHGCW STIPINAGLQ RNGKSCRLRW 60 INYLRPGLKR GTFSPQEEEK ILNLHSALGN K* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021730474.1 | 2e-51 | transcription factor LAF1-like | ||||
| Swissprot | Q9M0K4 | 1e-38 | LAF1_ARATH; Transcription factor LAF1 | ||||
| TrEMBL | A0A0D2UAY0 | 2e-45 | A0A0D2UAY0_GOSRA; Uncharacterized protein | ||||
| TrEMBL | A0A1U8NHU7 | 2e-45 | A0A1U8NHU7_GOSHI; transcription factor WER-like | ||||
| STRING | XP_010667574.1 | 4e-47 | (Beta vulgaris) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G48920.1 | 3e-41 | myb domain protein 45 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AHYPO_018889-RA |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




