![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AHYPO_019052-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 98aa MW: 11240.9 Da PI: 9.9498 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 61.9 | 1.4e-19 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEde+lv ++k++G g+W++ ++ g++R++k+c++rw +yl
AHYPO_019052-RA 15 KGPWTQEEDEKLVSYIKKHGLGSWRALPKAAGLNRCGKSCRLRWTNYL 62
79********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 3.3E-25 | 7 | 65 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 25.237 | 10 | 66 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.8E-15 | 14 | 64 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 8.0E-18 | 15 | 62 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 5.58E-23 | 16 | 88 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.75E-11 | 17 | 62 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.1E-6 | 66 | 87 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 98 aa Download sequence Send to blast |
MGRSPCCDDN IELKKGPWTQ EEDEKLVSYI KKHGLGSWRA LPKAAGLNRC GKSCRLRWTN 60 YLRPDIKRGH FNEQEEDMII KLHSVVKNCS PSSRKNR* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 2e-16 | 12 | 88 | 4 | 79 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269|PubMed:24902892}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269|PubMed:24902892}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021768213.1 | 6e-51 | transcription factor MYB39-like | ||||
| Swissprot | Q9S9Z2 | 3e-42 | MYB93_ARATH; Transcription factor MYB93 | ||||
| TrEMBL | A0A0J8B8I5 | 9e-49 | A0A0J8B8I5_BETVU; Uncharacterized protein | ||||
| TrEMBL | A0A0K9R2G5 | 5e-49 | A0A0K9R2G5_SPIOL; Uncharacterized protein | ||||
| STRING | XP_010695546.1 | 2e-49 | (Beta vulgaris) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G16770.2 | 1e-47 | myb domain protein 9 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AHYPO_019052-RA |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




