PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AHYPO_019891-RA

Organism

Amaranthus hypochondriacus

Taxonomic ID

28502

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus

Family

M-type_MADS

Protein Properties

Length: 102aa MW: 11671.3 Da PI: 10.1371

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AHYPO_019891-RA	genome	BYU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	96.5	1.1e-30	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLC+a++a+i+fss+g++ye+s+ AHYPO_019891-RA 9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCEADIALIVFSSRGRVYEFSN 59 79***********************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	5.3E-41	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.109	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.64E-40	2	72	No hit	No description
SuperFamily	SSF55455	7.06E-32	2	74	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.5E-32	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.2E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.5E-32	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.5E-32	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0048283	Biological Process	indeterminate inflorescence morphogenesis
GO:0048481	Biological Process	plant ovule development
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 102 aa Download sequence Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCE ADIALIVFSS RGRVYEFSNN 60 NNIRSTIERY KKAYTDGENS ATEINAQVKF VITIYSTHQF V*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	2e-19	1	64	1	64	Myocyte-specific enhancer factor 2B
1tqe_Q	2e-19	1	64	1	64	Myocyte-specific enhancer factor 2B
1tqe_R	2e-19	1	64	1	64	Myocyte-specific enhancer factor 2B
1tqe_S	2e-19	1	64	1	64	Myocyte-specific enhancer factor 2B
6c9l_A	2e-19	1	64	1	64	Myocyte-specific enhancer factor 2B
6c9l_B	2e-19	1	64	1	64	Myocyte-specific enhancer factor 2B
6c9l_C	2e-19	1	64	1	64	Myocyte-specific enhancer factor 2B
6c9l_D	2e-19	1	64	1	64	Myocyte-specific enhancer factor 2B
6c9l_E	2e-19	1	64	1	64	Myocyte-specific enhancer factor 2B
6c9l_F	2e-19	1	64	1	64	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in seed development. {ECO:0000269\|PubMed:29853599}.
UniProt	Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269\|PubMed:21447172, ECO:0000269\|PubMed:29853599, ECO:0000269\|Ref.1}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010683283.1	4e-49	PREDICTED: agamous-like MADS-box protein AGL11
Swissprot	A0A217EJJ0	9e-45	AG11S_VITVI; Agamous-like MADS-box protein AGL11
Swissprot	F6I457	9e-45	AG11C_VITVI; Agamous-like MADS-box protein AGL11
TrEMBL	A0A2H5QB37	1e-44	A0A2H5QB37_CITUN; Uncharacterized protein
STRING	XP_010683283.1	2e-48	(Beta vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G09960.4	4e-46	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	AHYPO_019891-RA

Publications ? help Back to Top
Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ Genome-wide analysis of MIKCC-type MADS box genes in grapevine. Plant Physiol., 2009. 149(1): p. 354-69 [PMID:18997115] Mejía N, et al. Molecular, genetic and transcriptional evidence for a role of VvAGL11 in stenospermocarpic seedlessness in grapevine. BMC Plant Biol., 2011. 11: p. 57 [PMID:21447172] Grimplet J,Martínez-Zapater JM,Carmona MJ Structural and functional annotation of the MADS-box transcription factor family in grapevine. BMC Genomics, 2016. 17: p. 80 [PMID:26818751] Malabarba J, et al. The MADS-box gene Agamous-like 11 is essential for seed morphogenesis in grapevine. J. Exp. Bot., 2017. 68(7): p. 1493-1506 [PMID:28369525] Royo C, et al. The Major Origin of Seedless Grapes Is Associated with a Missense Mutation in the MADS-Box Gene VviAGL11. Plant Physiol., 2018. 177(3): p. 1234-1253 [PMID:29853599]