PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G01530.1

Common Name

AGL28, F22L4.7

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

M-type_MADS

Protein Properties

Length: 247aa MW: 28029.6 Da PI: 9.8146

Description

AGAMOUS-like 28

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G01530.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	70.6	1.4e-22	17	62	4	49
-SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 n+sn qvtfskRr g++KK +EL++LCdae+a+i+fs++gk y + AT1G01530.1 17 TNESNLQVTFSKRRSGLFKKGSELCTLCDAEIAIIVFSPSGKAYSF 62 699***************************************9988 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	8.3E-34	6	65	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	25.609	6	66	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	3.01E-26	7	86	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.35E-32	7	73	No hit	No description
PRINTS	PR00404	1.1E-20	8	28	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	5.2E-24	16	62	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-20	28	43	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-20	43	64	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009911	Biological Process	positive regulation of flower development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000036	anatomy	leaf vascular system
PO:0005660	anatomy	hydathode
PO:0009005	anatomy	root
PO:0009009	anatomy	plant embryo
PO:0009089	anatomy	endosperm
PO:0020090	anatomy	embryo sac central cell
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage

Sequence ? help Back to Top
Protein Sequence Length: 247 aa Download sequence Send to blast
MARKNLGRRK IELVKMTNES NLQVTFSKRR SGLFKKGSEL CTLCDAEIAI IVFSPSGKAY 60 SFGHPNVNKL LDHSLGRVIR HNNTNFAESR TKLRIQMLNE SLTEVMAEKE KEQETKQSIV 120 QNERENKDAE KWWRNSPTEL NLAQSTSMKC DLEALKKEVD EKVAQLHHRN LNFYVGSSSN 180 VAAPAAVSGG NISTNHGFFD QNGNSTSAPT LPFGFNVMNR TPAGYNSYQL QNQEVKQVHP 240 QYWARYY

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	7e-16	6	71	1	66	MEF2 CHIMERA
6byy_B	7e-16	6	71	1	66	MEF2 CHIMERA
6byy_C	7e-16	6	71	1	66	MEF2 CHIMERA
6byy_D	7e-16	6	71	1	66	MEF2 CHIMERA
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.42643	0.0	seed

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	259427_at	0.0
Expression Atlas	AT1G01530	-
AtGenExpress	AT1G01530	-
ATTED-II	AT1G01530	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in the embryo at the globular stage and in endosperm nuclei and chalazal endosperm of developing seeds. {ECO:0000269\|PubMed:16899218}.
Uniprot	TISSUE SPECIFICITY: Expressed in roots, leaves and shoot apices. {ECO:0000269\|PubMed:16899218}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that may function as a floral promoter operating upstream of known floral activators in the autonomous pathway. {ECO:0000269\|PubMed:16899218}.

Function -- GeneRIF ? help Back to Top
AGL28 plays a role in the vegetative phase in Arabidopsis and is a positive regulator of known floral promoters within the autonomous pathway [AGAMOUS-LIKE 28] [AGL28] [PMID: 16899218]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G01530.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT4G02560(A), AT4G16280(A)

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT1G31630, AT1G65300, AT1G65330
IntAct	Search Q9LMM8

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: No visible phenotype under normal growth conditions. {ECO:0000269\|PubMed:16899218}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G01530

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	DQ446218	0.0	DQ446218.1 Arabidopsis thaliana clone pENTR221-At1g01530 MADS-box protein (At1g01530) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_171660.1	0.0	AGAMOUS-like 28
Swissprot	Q9LMM8	0.0	AGL28_ARATH; Agamous-like MADS-box protein AGL28
TrEMBL	A0A178WE04	0.0	A0A178WE04_ARATH; AGL28
STRING	AT1G01530.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM17507	7	10
Representative plant	OGRP16	17	761

Link Out ? help Back to Top
Phytozome	AT1G01530.1
Entrez Gene	837142
iHOP	AT1G01530
wikigenes	AT1G01530

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Menges M,Hennig L,Gruissem W,Murray JA Cell cycle-regulated gene expression in Arabidopsis. J. Biol. Chem., 2002. 277(44): p. 41987-2002 [PMID:12169696] De Bodt S, et al. Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants. J. Mol. Evol., 2003. 56(5): p. 573-86 [PMID:12698294] Parenicová L, et al. Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] Kofuji R, et al. Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses. Mol. Biol. Evol., 2003. 20(12): p. 1963-77 [PMID:12949148] Scheible WR, et al. Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen. Plant Physiol., 2004. 136(1): p. 2483-99 [PMID:15375205] de Folter S, et al. Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] Pina C,Pinto F,Feij Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation. Plant Physiol., 2005. 138(2): p. 744-56 [PMID:15908605] Yoo SK,Lee JS,Ahn JH Overexpression of AGAMOUS-LIKE 28 (AGL28) promotes flowering by upregulating expression of floral promoters within the autonomous pathway. Biochem. Biophys. Res. Commun., 2006. 348(3): p. 929-36 [PMID:16899218] Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations. Plant Biotechnol. J., 2006. 4(3): p. 317-24 [PMID:17147637] Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis. Plant Physiol., 2010. 154(1): p. 287-300 [PMID:20631316] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Cheng JZ,Zhou YP,Lv TX,Xie CP,Tian CE Research progress on the autonomous flowering time pathway in Arabidopsis. Physiol Mol Biol Plants, 2017. 23(3): p. 477-485 [PMID:28878488] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711] Terryn N, et al. Sequence analysis of a 40-kb Arabidopsis thaliana genomic region located at the top of chromosome 1. Gene, 1998. 215(1): p. 11-7 [PMID:9666060]