![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT1G03970.1 | ||||||||
| Common Name | BZIP40, F21M11.10, GBF4 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 270aa MW: 30586.2 Da PI: 5.7461 | ||||||||
| Description | G-box binding factor 4 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 58.3 | 1.7e-18 | 186 | 247 | 2 | 63 |
XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
++ +r++r++kNRe+A rsR+RK+a++ eLe+ +++Le+eN++L ke+ee +ke +k +ev
AT1G03970.1 186 AAAQRQKRMIKNRESAARSRERKQAYQVELETLAAKLEEENEQLLKEIEESTKERYKKLMEV 247
5789***************************************************9988875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.20.5.170 | 3.3E-14 | 184 | 240 | No hit | No description |
| SMART | SM00338 | 1.3E-14 | 185 | 249 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 1.1E-17 | 186 | 247 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 11.277 | 187 | 239 | IPR004827 | Basic-leucine zipper domain |
| CDD | cd14707 | 4.39E-18 | 189 | 235 | No hit | No description |
| SuperFamily | SSF57959 | 1.38E-10 | 189 | 241 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 192 | 207 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000013 | anatomy | cauline leaf | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0000230 | anatomy | inflorescence meristem | ||||
| PO:0000293 | anatomy | guard cell | ||||
| PO:0008019 | anatomy | leaf lamina base | ||||
| PO:0009005 | anatomy | root | ||||
| PO:0009006 | anatomy | shoot system | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009010 | anatomy | seed | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009029 | anatomy | stamen | ||||
| PO:0009030 | anatomy | carpel | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009047 | anatomy | stem | ||||
| PO:0009052 | anatomy | flower pedicel | ||||
| PO:0020030 | anatomy | cotyledon | ||||
| PO:0020038 | anatomy | petiole | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0020137 | anatomy | leaf apex | ||||
| PO:0025022 | anatomy | collective leaf structure | ||||
| PO:0025281 | anatomy | pollen | ||||
| PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
| PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
| PO:0001081 | developmental stage | mature plant embryo stage | ||||
| PO:0001185 | developmental stage | plant embryo globular stage | ||||
| PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
| PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
| PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
| PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
| PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
| PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 270 aa Download sequence Send to blast |
MASFKLMSSS NSDLSRRNSS SASSSPSIRS SHHLRPNPHA DHSRISFAYG GGVNDYTFAS 60 DSKPFEMAID VDRSIGDRNS VNNGKSVDDV WKEIVSGEQK TIMMKEEEPE DIMTLEDFLA 120 KAEMDEGASD EIDVKIPTER LNNDGSYTFD FPMQRHSSFQ MVEGSMGGGV TRGKRGRVMM 180 EAMDKAAAQR QKRMIKNRES AARSRERKQA YQVELETLAA KLEEENEQLL KEIEESTKER 240 YKKLMEVLIP VDEKPRPPSR PLSRSHSLEW |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.26664 | 0.0 | flower| root | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| Genevisible | 265040_at | 0.0 | ||||
| Expression Atlas | AT1G03970 | - | ||||
| AtGenExpress | AT1G03970 | - | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| TAIR | encodes a basic leucine zipper G-box binding factor that can bind to G-box motifs only as heterodimers with GBF2 or GBF3. A single amino acid change can confer G-box binding as homodimers. | |||||
| UniProt | Binds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter. G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control. {ECO:0000269|PubMed:8146148}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT1G03970.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT1G03970 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC003027 | 0.0 | AC003027.1 Arabidopsis thaliana chromosome I BAC F21M11 genomic sequence, complete sequence. | |||
| GenBank | AY087603 | 0.0 | AY087603.1 Arabidopsis thaliana clone 36980 mRNA, complete sequence. | |||
| GenBank | BT024495 | 0.0 | BT024495.1 Arabidopsis thaliana At1g03970 mRNA, complete cds. | |||
| GenBank | CP002684 | 0.0 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. | |||
| GenBank | U01823 | 0.0 | U01823.1 Arabidopsis thaliana Columbia bZIP protein GBF4 gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_171893.1 | 0.0 | G-box binding factor 4 | ||||
| Swissprot | P42777 | 0.0 | GBF4_ARATH; G-box-binding factor 4 | ||||
| TrEMBL | A0A384LG29 | 0.0 | A0A384LG29_ARATH; GBF4 | ||||
| TrEMBL | Q2HIT6 | 0.0 | Q2HIT6_ARATH; At1g03970 | ||||
| STRING | AT1G03970.1 | 0.0 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM3852 | 28 | 55 | Representative plant | OGRP8662 | 7 | 15 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT1G03970.1 |
| Entrez Gene | 839356 |
| iHOP | AT1G03970 |
| wikigenes | AT1G03970 |




