| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 54 | 3.8e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+W++eEd +l++++ ++G ++W++ ++ g+ R++k+c++rw +yl
AT1G06180.1 14 KGPWSAEEDRILINYISLHGHPNWRALPKLAGLLRCGKSCRLRWINYL 61
79******************************99************97 PP
|
| 2 | Myb_DNA-binding | 50.5 | 4.9e-16 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg++T+ E++ ++ ++++lG++ W++Ia++++ gRt++++k+ w+++l
AT1G06180.1 67 RGNFTPHEEDTIISLHQLLGNR-WSAIAAKLP-GRTDNEIKNVWHTHL 112
89********************.*********.************986 PP
|
| Publications
? help Back to Top |
- Vicient CM,Bies-Etheve N,Delseny M
Changes in gene expression in the leafy cotyledon1 (lec1) and fusca3 (fus3) mutants of Arabidopsis thaliana L. J. Exp. Bot., 2000. 51(347): p. 995-1003 [PMID:10948227] - Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Stracke R,Werber M,Weisshaar B
The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] - Steffens NO,Galuschka C,Schindler M,B
AthaMap: an online resource for in silico transcription factor binding sites in the Arabidopsis thaliana genome. Nucleic Acids Res., 2004. 32(Database issue): p. D368-72 [PMID:14681436] - Yanhui C, et al.
The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] - Oravecz A, et al.
CONSTITUTIVELY PHOTOMORPHOGENIC1 is required for the UV-B response in Arabidopsis. Plant Cell, 2006. 18(8): p. 1975-90 [PMID:16829591] - Nozawa A,Miwa K,Kobayashi M,Fujiwara T
Isolation of Arabidopsis thaliana cDNAs that confer yeast boric acid tolerance. Biosci. Biotechnol. Biochem., 2006. 70(7): p. 1724-30 [PMID:16861809] - Cao D,Cheng H,Wu W,Soo HM,Peng J
Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis. Plant Physiol., 2006. 142(2): p. 509-25 [PMID:16920880] - AbuQamar S, et al.
Expression profiling and mutant analysis reveals complex regulatory networks involved in Arabidopsis response to Botrytis infection. Plant J., 2006. 48(1): p. 28-44 [PMID:16925600] - Xin Z,Mandaokar A,Chen J,Last RL,Browse J
Arabidopsis ESK1 encodes a novel regulator of freezing tolerance. Plant J., 2007. 49(5): p. 786-99 [PMID:17316173] - Bedon F,Grima-Pettenati J,Mackay J
Conifer R2R3-MYB transcription factors: sequence analyses and gene expression in wood-forming tissues of white spruce (Picea glauca). BMC Plant Biol., 2007. 7: p. 17 [PMID:17397551] - Kleine T,Kindgren P,Benedict C,Hendrickson L,Strand A
Genome-wide gene expression analysis reveals a critical role for CRYPTOCHROME1 in the response of Arabidopsis to high irradiance. Plant Physiol., 2007. 144(3): p. 1391-406 [PMID:17478635] - Ascencio-Ib
Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] - Huang BH, et al.
Positive selection and functional divergence of R2R3-MYB paralogous genes expressed in inflorescence buds of Scutellaria species (Labiatae). Int J Mol Sci, 2015. 16(3): p. 5900-21 [PMID:25782156] - Kirik V,K
Ectopic expression of a novel MYB gene modifies the architecture of the Arabidopsis inflorescence. Plant J., 1998. 13(6): p. 729-42 [PMID:9681014] - Kranz HD, et al.
Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]
|