PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G07900.1
Common NameASL8, F24B9.1, LBD1
Organism
Arabidopsis thaliana
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 190aa    MW: 21410.3 Da    PI: 5.2824
Description LOB domain-containing protein 1
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G07900.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.42.6e-4333131199
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca+ Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r+da++s+vyeAear+rdPvyG++g i +lq+q+++l+a+la+++
  AT1G07900.1  33 PCAACKILRRRCAERCVLAPYFPPTDPAKFTIAHRVFGASNIIKFLQELPESQRTDAVNSMVYEAEARIRDPVYGCAGAIYHLQRQVSELQAQLAKAQ 130
                  7**********************************************************************************************998 PP

       DUF260  99 e 99 
                   
  AT1G07900.1 131 V 131
                  6 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.34132133IPR004883Lateral organ boundaries, LOB
PfamPF031953.9E-4333130IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008150Biological Processbiological_process
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MESKSDASVA TTPIISSSSS PPPSLSPRVV LSPCAACKIL RRRCAERCVL APYFPPTDPA  60
KFTIAHRVFG ASNIIKFLQE LPESQRTDAV NSMVYEAEAR IRDPVYGCAG AIYHLQRQVS  120
ELQAQLAKAQ VEMVNMQFQR SNLLELIYNM DQQQKQEQDN MSFESNDLGF LEDKSNTNSS  180
MLWWDPLWTC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-423213410112LOB family transfactor Ramosa2.1
5ly0_B1e-423213410112LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2402540370.0
Expression AtlasAT1G07900-
AtGenExpressAT1G07900-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G07900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT3G01470 (R)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G07900
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738410.0AB473841.1 Arabidopsis thaliana ASL8 mRNA for ASYMMETRIC LEAVES2-like 8 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_172268.11e-141LOB domain-containing protein 1
SwissprotQ9LQR01e-142LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A178WM561e-140A0A178WM56_ARATH; LBD1
STRINGAT1G07900.11e-140(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Representative plantOGRP6016318
Publications ? help Back to Top
  1. Millar AH,Sweetlove LJ,Gieg
    Analysis of the Arabidopsis mitochondrial proteome.
    Plant Physiol., 2001. 127(4): p. 1711-27
    [PMID:11743115]
  2. Iwakawa H, et al.
    The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana, required for formation of a symmetric flat leaf lamina, encodes a member of a novel family of proteins characterized by cysteine repeats and a leucine zipper.
    Plant Cell Physiol., 2002. 43(5): p. 467-78
    [PMID:12040093]
  3. Shuai B,Reynaga-Peña CG,Springer PS
    The lateral organ boundaries gene defines a novel, plant-specific gene family.
    Plant Physiol., 2002. 129(2): p. 747-61
    [PMID:12068116]
  4. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  5. Heazlewood JL, et al.
    Experimental analysis of the Arabidopsis mitochondrial proteome highlights signaling and regulatory components, provides assessment of targeting prediction programs, and indicates plant-specific mitochondrial proteins.
    Plant Cell, 2004. 16(1): p. 241-56
    [PMID:14671022]
  6. Wagner R,Pfannschmidt T
    Eukaryotic transcription factors in plastids--Bioinformatic assessment and implications for the evolution of gene expression machineries in plants.
    Gene, 2006. 381: p. 62-70
    [PMID:16934950]
  7. Matsumura Y,Iwakawa H,Machida Y,Machida C
    Characterization of genes in the ASYMMETRIC LEAVES2/LATERAL ORGAN BOUNDARIES (AS2/LOB) family in Arabidopsis thaliana, and functional and molecular comparisons between AS2 and other family members.
    Plant J., 2009. 58(3): p. 525-37
    [PMID:19154202]
  8. Ariel F, et al.
    Environmental regulation of lateral root emergence in Medicago truncatula requires the HD-Zip I transcription factor HB1.
    Plant Cell, 2010. 22(7): p. 2171-83
    [PMID:20675575]
  9. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  10. Yordanov YS,Regan S,Busov V
    Members of the LATERAL ORGAN BOUNDARIES DOMAIN transcription factor family are involved in the regulation of secondary growth in Populus.
    Plant Cell, 2010. 22(11): p. 3662-77
    [PMID:21097711]
  11. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  12. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]